KEGG   Beutenbergia cavernae: Bcav_2873Help
Entry
Bcav_2873         CDS       T00893                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bcv  Beutenbergia cavernae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bcv03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3207428..3208336
Genome map
AA seq 302 aa AA seqDB search
MGRMPELPEVDALGEFLRERVVGREIVAVHIAQIGALKTFDPPLTDLVGRTVTGVERHGK
WLDLALGRRGDADDGEPHLVFHLAKAGWLRWKDEMPPASTPAGRPMGRRAGPLALRVWLD
DGAGFDLTEAGTRKRLAVHVVGSPEEVGPIASLGFDPRSELTAERLGAALRTRNQQLKGA
LRDQTLVAGIGNAYSDEILHAARMSPFTLTKSLTDDDVARLTDATRQVLDAAVAAASGKP
AAELKDAKRRGMAVHGRTGETCPVCGDVVREVSFADRSLQYCATCQTGGVPLADRRMSKL
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcatgccagagctgccggaggtcgacgctctcggcgagttcctgcgggaacgc
gtcgtggggcgcgagatcgtcgccgtccacatcgcccagatcggcgccctgaagacgttc
gacccgccgctcaccgacctggtcgggcgcaccgtcaccggcgtggagcggcacgggaag
tggctcgacctcgcgctcgggcggcgcggcgatgccgatgacggcgaaccgcacctcgtc
ttccacctcgccaaggcgggatggttgcgctggaaggacgagatgccgcccgcgtccacg
cccgcgggtcgtcccatgggccggcgcgcggggccgctcgcgctgcgggtgtggctcgac
gacggcgccggcttcgacctcacggaggccggcacgcgcaagcggctcgccgtgcacgtg
gtcggctcgccggaggaggtcggaccgatcgcgagcctcggcttcgaccctcgctccgag
ctgaccgccgaacgcctgggggcggcgctgcggacgcgcaaccagcagctgaagggcgcc
ctgcgggaccagacgctggtcgccgggatcggcaacgcctactcggacgagatcctgcac
gcggcgcggatgtccccgttcacgctgacgaagtcgctgacggacgacgacgtcgctcgc
ctcacggacgcgacccgccaggtgctcgacgccgccgtcgcggccgcgagcgggaagccg
gcggccgagctcaaggacgcgaagcgccgaggcatggccgtccacgggcggaccggcgag
acgtgcccggtgtgcggcgacgtcgtccgcgaggtctccttcgcggaccgcagcctgcag
tactgcgccacgtgccagaccggcggcgtgcccctggcggaccgcaggatgtcgaagctc
ctgcgctag

DBGET integrated database retrieval system