KEGG   Beutenbergia cavernae: Bcav_2896Help
Entry
Bcav_2896         CDS       T00893                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bcv  Beutenbergia cavernae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcav_2896
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcav_2896
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcav_2896
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bcav_2896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3231929..3233497)
Genome map
AA seq 522 aa AA seqDB search
MPVQPLALPRRSFLTLTGVAAGSAVMLGTEPALAGPGQLPTDPLFTLGVASGDPHPDGVV
LWTRLAPEPLALDGLGGMPDIAVNVAWDVAEDEGFRRVVRRGVERATASWGHSVHAEVRG
LRPDRVYWFRFRAGGQVSPVGRTRTAPARGARLGDVTFAFASCQNVPDGYFTALRHLATE
DVDFILHLGDYIYEGSSAGSIGRPHLPAAEVFSLSDYRIRYSQYKLDVDLQAAHAAAPWI
VAPDDHDVENNWAGDHSQPDSEPDQDPAVFRLRRAAAYQAYYENLPMRRSSMPRGPEMQV
FRRLQFGDLLQLDVLDTRRFRDQLLTDQSQRWDPARQILGAEQEAWLLAGLGAATARWKV
LGNQVFMFDADHTAGEGERYGMDTWGGYAAARQRLFDGLVERDVENFLVVTGDAHRSAAS
DLKLDFADMSSRTVGTEFLGTSISSGKDGADMDDLGAVWLAENPFLSFHNAQRGYQVCRL
GRDEMRTDYRVVPFVSEPGAAVSTRASVYVQSGRAGVAHVSE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtccagccgctcgctctgccccgccgctcgttcctcacgctcaccggcgtggcc
gccggatcggccgtcatgctcggcaccgagccggccctcgctggtcccgggcagctcccc
accgatccgctgttcacgctcggcgtggcgtccggcgacccgcaccccgacggggtcgtc
ctgtggacgcgactggcgcccgagccgttggcgctcgacggactgggcgggatgccggac
atcgccgtcaacgtggcgtgggacgtggcggaggacgaggggttccgtcgcgtcgtgcgg
cgcggcgtcgaacgggcgacggcgtcgtggggccacagcgtgcacgcggaggtccgcgga
ctgcgtcctgatcgcgtgtactggttccggttccgcgcgggtggccaggtgagtccggtc
gggcgcacccgcaccgcgcccgcccggggcgcccgcctcggtgacgtgacgttcgcgttc
gcgagctgccagaacgtcccggacgggtacttcacggctctgcggcacctcgcgaccgag
gacgtcgacttcatcctgcacctcggcgactacatctacgagggcagctcagcggggtcg
atcggtcgcccgcacctccccgcggcggaggtcttctcgctcagcgactaccggatccgg
tactcgcagtacaagctcgacgtcgacctccaggcggcgcacgctgctgccccgtggatc
gtggccccggacgaccacgacgtcgagaacaactgggctggtgaccattcgcagccggac
agcgagccggaccaggacccggcggtgttccggttgcggcgcgccgcggcctaccaggcg
tactacgagaacctcccgatgcggcgctcgtcgatgccgcgcgggccggagatgcaggtc
ttccggcgcctgcagttcggcgacctgctccagctcgacgtgctcgacacgcgccggttc
cgcgaccagctgctgacggaccagtcccagcgctgggatcccgcgcggcagatcctcggc
gcggagcaggaggcgtggctgctcgcgggactcggcgccgcgacggccagatggaaggtg
ctcggcaaccaggtgttcatgttcgacgccgaccacaccgccggcgagggcgagcggtac
gggatggacacgtggggcggttacgcagctgcccggcagcgcctgttcgacgggctggtc
gagcgcgatgtcgagaacttcctcgtcgtgaccggggacgcgcaccgcagtgccgcgtcg
gacctcaagctggacttcgccgacatgtcctcgcgcaccgtgggcaccgagttcctgggg
acgtcgatcagctcgggcaaggacggcgcggacatggacgacctcggtgcggtgtggctg
gccgagaacccgttcctgtccttccacaacgcccagcgtgggtaccaggtgtgccggctg
ggacgcgacgagatgcggaccgactaccgggtggtgcccttcgtcagcgagcccggggcg
gcggtctcgacacgggcgagcgtctacgtgcagtccggccgcgccggcgtggcgcacgtc
agcgagtag

DBGET integrated database retrieval system