KEGG   Beutenbergia cavernae: Bcav_2940Help
Entry
Bcav_2940         CDS       T00893                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.2 2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bcv  Beutenbergia cavernae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcav_2940
Enzymes [BR:bcv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Bcav_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3280169..3281464)
Genome map
AA seq 431 aa AA seqDB search
MAEPFDAVDVIRTKRDGGALTTAQIDWVLDAYVRDAVAEEQMAALAMAILLRGLSREELA
AWTTAMIASGERMDFSGLSRPTVDKHSTGGVGDKITLPLAPLVATFDVAVPQLSGRGLGH
TGGTLDKLEAIPGWRAALTNDEMLAQLDDVGAVICQAGSGLAPADRRLYALRDVTGTVES
IPLIASSIMSKKIAEGTGALVLDVKVGSGAFMKDLDDARELARTMVALGTDAGVTTTALL
TDMSTPLGLTAGNALEVRESVEVLAGGGPADVVELTLALAREMLDAAGRPDADPAAALAD
GRAMDTWRRMIAAQGGDPDAPLPSARHSEDVLAPADGVLVTLDAYAVGVAAWRLGAGRAR
REDPVQAGAGVELHAKPGALVRAGERLLTLHTDTPERFARAHEALEAAVTIAPEGARPAG
GGVVLERVDAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcccttcgacgccgtcgacgtcatccgcacgaagcgcgacggcggggcgctc
accaccgcacagatcgactgggtcctggacgcctacgtccgggacgccgtcgccgaggag
cagatggccgcgctcgcgatggcgatcctgctgcgcgggctctcccgcgaggagcttgcc
gcgtggacgacggcgatgatcgcgagcggcgagcggatggacttctccgggctgtcgcgg
ccgaccgtcgacaagcactcgacgggcggggtcggcgacaagatcacgctcccgctcgca
ccgctcgtggccacgttcgacgtcgcggtcccgcagctgtccggccgcgggctcggccac
acgggcggcacgctcgacaagctcgaggcgatccccggctggcgggcggccctcacgaac
gacgagatgctcgcccagctcgacgacgtcggtgcggtgatctgtcaggcaggatctggg
ctcgctcccgctgaccggaggctgtacgcgctgcgcgacgtcaccgggacggtggagtcg
atcccgctgatcgcgagctcgatcatgagcaagaagatcgcggagggcaccggcgcgctg
gtcctcgacgtcaaggtcgggtcgggggcgttcatgaaggacctcgacgacgcgcgggag
ctcgcgcgcacgatggtcgccctgggcacggatgcgggggtgacgacgacggcgctgctc
accgacatgtcgacgccgctcgggctcacggccgggaacgcgctcgaggtgcgggagtcg
gtcgaggtgctcgccggcgggggaccggccgacgtcgtcgaactgaccctcgccctcgcc
cgcgagatgctcgacgccgccggccgcccggacgccgaccccgccgccgcgctcgcggac
ggccgggcgatggacacctggcggcgcatgatcgcggcgcagggcggcgacccggacgcg
ccgctgccgagcgcccggcacagcgaggacgtgctcgcccccgcggacggcgtgctcgtg
acgctcgacgcgtacgccgtgggggtcgccgcgtggcggctcggcgcgggccgcgcccgc
cgggaggacccggtgcaggcgggcgccggcgtcgagctgcacgcgaagccgggcgcgctg
gtccgggccggggagcgcctgctcaccctccacacggacacgccggaacggttcgcgcgc
gcgcacgaggcgctcgaggcggccgtgacgatcgcacccgagggcgcccggcccgccggc
ggcggcgtcgtgctcgaacgcgtggacgcggcgtga

DBGET integrated database retrieval system