KEGG   Beutenbergia cavernae: Bcav_2951Help
Entry
Bcav_2951         CDS       T00893                                 

Definition
succinate dehydrogenase cytochrome b556 subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bcv  Beutenbergia cavernae
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcav_2951
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcav_2951
   00650 Butanoate metabolism
    Bcav_2951
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcav_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3292795..3293253
Genome map
AA seq 152 aa AA seqDB search
MATIDDGVIANPRARYTRRLRTPGNSELWAWIFMRASGVLLIVLIFGHLFVNLLVGDGVG
AIDFAFVGGKWASPFWQVWDLLMLWLAMIHGTNGVRTIINDYAERDVTRVVLKSLLYLAF
VVTVVLGTLVIFTFDPCPTGAAAHLLPSFCTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatcgacgacggcgtcatcgccaacccgcgggcgcggtacacccggcgcctg
cgcacgcccggcaacagcgagctgtgggcctggatcttcatgcgcgcctcgggcgtgctg
ctcatcgtgctgatcttcgggcacctgttcgtcaacctgctcgtgggcgacggtgtcggc
gcgatcgacttcgcgttcgtgggcggcaagtgggcctccccgttctggcaggtctgggac
ctcctcatgctgtggctcgcgatgatccacggcacgaacggcgtccgcacgatcatcaac
gactacgcggagcgcgacgtgacgcgcgtcgtcctcaagtcgctcctctacctcgcgttc
gtcgtcaccgtcgtcctcggcacgctcgtgatcttcacgttcgacccgtgccccaccggc
gccgcggcgcacctgctgccgtcgttctgcaccgcctga

DBGET integrated database retrieval system