KEGG   Beutenbergia cavernae: Bcav_3076Help
Entry
Bcav_3076         CDS       T00893                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcv  Beutenbergia cavernae
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcv00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3428338..3430386
Genome map
AA seq 682 aa AA seqDB search
MATSTTWPGGSVVAFGGDYNPEQWPRETWAEDLALMRKAGVTLVSVGIFAWAALEPREGA
FDFCWLDDLLDLLHAGGIAVDLATPTASPPAWFFATYPEARVVTRDGTALGFGSRGMASP
SSPAYRRASVRIATALAERYADHPAVVMWHVHNEYGAPVGEDYSPAAVTAFRAWLRARYG
SLDALNSAWGTAFWGQTYGAWSHVGAPAATASVANPAQRLDFARFTDHQLRACFVAERDA
IRAHASQPVTTNFMAAECLTTDLWAWAREVDIISNDHYLTAADPRGHVGLALAADLTRSV
AGGRPWLLMEHSTSAVNWQPRNIAKRPGEMARNSLAHLARGADGILFFQWRASRAGAEKF
HSAMLPHAGTSSRVWHEVTALGADVARLAPVQGSRVRADAAILWDTESLWAQGLDWHPSV
DVRAQERIRAYYERLWLDGVTVDFAHPAADLASYRLVVAPASYLLTQAAADNLRAYVAGG
GTLVVSFFSAIVDENDAVHRGGFVAPLREVLGLTVEEFLPLRAAETTRLAWADGDGDGGR
ELVADVWQEHIALEGADVVATYLDGPARGRAAITRRRHGSGTGWYVSTRLGIPELAPVLR
AAYADAGIAPSDRPQDVEIVTRHGDDADFLVAINHGDEDVKVHLSRGVELLSGDPVTGAL
DLPAGAVAVVRVEQADAGGGGR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagcacgacctggcccggtggctccgtcgtcgcgttcggtggcgactacaac
cccgagcagtggccgcgcgagacgtgggccgaggatctcgcgctcatgcgcaaggccggt
gtgacgctcgtcagcgtcggcatcttcgcctgggcggcgctcgaacctcgtgagggagcg
ttcgacttctgctggctcgacgaccttctcgacctcctccacgcgggcgggatcgccgtc
gacctcgcgacgccgacggcgtcacctcccgcctggttcttcgccacctaccccgaggca
cgggtcgtgacgcgcgacggcacagcgctcgggttcggctcgcgcggcatggcgtcgccc
agctcccccgcctaccgccgggcgtccgtgcgcatcgcgacggcactcgcggagcgctac
gccgaccaccctgccgtcgtcatgtggcacgtccacaacgagtacggcgcgcccgtcggg
gaggactactcccccgccgccgtcaccgccttccgcgcctggctgcgggcgcggtacggc
tcgctggacgcactcaacagcgcctggggcacggcgttctgggggcagacctacggggcg
tggtcgcacgtcggggcgccggccgccaccgcgtcggtcgccaaccccgcgcagcgactc
gacttcgcccgcttcaccgaccaccagctgcgggcgtgcttcgtcgcggagcgggacgcg
atccgtgcccacgcctcgcagccggtgaccacgaacttcatggcagccgagtgcctgacg
acggacctgtgggcctgggcgcgcgaggtcgacatcatctcgaacgaccactacctgacg
gccgccgacccgcggggacacgtcggcctcgccctcgcggccgacctgacccggtcggta
gccggtgggcggccgtggctcctcatggagcactcgacgtcggccgtgaactggcagccc
cggaacatcgccaagaggccgggtgagatggcccggaactcgctcgcgcacctggcgcgc
ggcgccgacgggatcctcttcttccagtggcgggcgtcacgcgcgggggcggagaagttc
cactccgcgatgctgccgcacgccggcacgagctcgcgcgtgtggcacgaggtgacggcg
ctcggagccgacgtcgcccgcctcgcgccggtgcagggctcgcgtgtgcgggcggacgcc
gcgatcctctgggacacggagtcgctctgggcccaggggctcgactggcacccgtccgtg
gacgtgcgcgcccaggaacggatccgcgcgtactacgagcgactctggctcgacggcgtc
accgtcgacttcgcccatccggcggccgacctcgcgagctaccggctcgtcgtcgccccg
gcgtcgtacctgctcacccaggcggcggccgacaacctgcgggcgtacgtcgccgggggc
ggcaccctcgtcgtctcgttcttctcggcgatcgtcgacgagaacgacgcggtccaccgc
ggcggcttcgtcgcgccgctgcgcgaggtcctcggcctcacggtcgaggagttcctgccc
ttgcgggccgcggagaccacccgcctggcctgggccgacggcgacggcgacggcgggcgc
gagctggtcgctgacgtctggcaggagcacatcgccctggagggggccgacgtcgtcgcg
acgtacctcgacggaccggcgcgaggtcgcgcggcgatcacccgccgtcgtcacgggtcc
ggcaccgggtggtacgtctcgacccgcctcgggatccccgagctcgcccccgtgctccgc
gccgcctacgccgacgcggggatcgcgccgtcggaccgtcctcaggacgtcgagatcgtg
acccgccacggcgacgacgccgacttcctggtggcgatcaaccacggcgacgaggacgtg
aaggtgcacctctcccgcggcgtcgagctgctctccggtgaccccgtgaccggggcgctg
gacctcccggccggcgccgtcgccgtcgtacgcgtcgagcaggccgacgccggcgggggt
ggtcgatga

DBGET integrated database retrieval system