KEGG   Beutenbergia cavernae: Bcav_3110Help
Entry
Bcav_3110         CDS       T00893                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00010  Glycolysis / Gluconeogenesis
bcv00520  Amino sugar and nucleotide sugar metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
Module
bcv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_3110
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_3110
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Bcav_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACQ81354
UniProt: C5C0F8
Position
3472740..3473498
Genome map
AA seq 252 aa AA seqDB search
MEPISTLAVDCGGGGIKASVLDVAGTMHAQPVRTATPYPLPPDRLVETIVELAGRLPDAQ
RVTVGMPGMIRHGVVVATPHYVTRAGPRTKVLPELVDAWSGFDMASAVSRELGIPALVLN
DAEVHGAGVVAGAGLELVLTFGTGLGNALFDGGALAPHLELSQGPVRWGLTYDGYVGEHE
RIRLGDAMWSRRIRRVVEALRPIFVWDRVYLGGGNSRRITPQTLDKLGDDVVVVPNSAGI
IGGVRAWTLRTP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagccgatctcgacgctggcggtcgactgcggcggcggcgggatcaaggcctcggtc
ctcgacgtcgccggcacgatgcatgcccagcccgtgcgcaccgcgacgccgtatcccctg
ccccccgaccggctcgtggagaccatcgtcgagctggccggccggctgcccgacgcccaa
cgggtgaccgtgggcatgccggggatgatccgccacggcgtcgtcgtcgcgacaccgcac
tacgtcacgcgggccgggccccgcacgaaggtgctgcccgagctcgtcgacgcctggagc
ggcttcgacatggcgagcgccgtctcccgggagctcggcatcccggcgctggtgctcaac
gacgccgaggtccacggggcgggcgtcgtggcgggggcgggcctcgagctcgtgctcacg
ttcggcaccgggctcggcaacgccctgttcgacggcggcgcgctcgctcctcacctggag
ctgagccaggggccggtgcgctggggcctgacgtacgacgggtacgtgggcgagcacgag
cgcatccgcctgggcgacgcgatgtggtcgcggcggatccggcgcgtcgtcgaggcgctc
cggccgatcttcgtgtgggaccgggtgtatctcggcggcggcaactcgcgtcggatcacg
ccgcagacgctcgacaagctcggggacgacgtcgtcgtcgtcccgaacagcgccgggatc
atcgggggcgtacgggcctggacgctgcggaccccctga

DBGET integrated database retrieval system