KEGG   Beutenbergia cavernae: Bcav_3221Help
Entry
Bcav_3221         CDS       T00893                                 

Definition
NADH-quinone oxidoreductase subunit I
Orthology
K00338  
NADH-quinone oxidoreductase subunit I [EC:1.6.5.3]
Organism
bcv  Beutenbergia cavernae
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcav_3221
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Bcav_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3577285..3578049)
Genome map
AA seq 254 aa AA seqDB search
MAEPKKRPATGRPQPKGAAPARRRPAAPPAKRQAPARPEPESGEKGGLGELLAPVAGFGV
TFSSMFRPSMTEQYPFEKKPTQPRYHGRHQLNRYADGLEKCIGCELCAWACPADAIYVEG
ADNSPDAQFSPGERYGRVYQINYLRCIFCGLCIEACPTRALTMTNDFELAGPTREGLIFT
KDELLAPLREGQLAAPHPMVAGTVDDDYYRGEVTGPTTDQVDWVAEQRPDDPTLPAARAA
ADAEATAERAKAAR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgaagaagcggccggcgaccggccgcccgcagccgaagggcgctgcgccg
gcccggcgtcgtcccgcagcgccgcccgcgaagcgccaggcgcccgcgcgacccgagccg
gagtccggcgagaagggcgggctcggggagctcctggcgcccgtcgccgggttcggcgtc
acgttctcgtcgatgttccggccgtcgatgacggagcagtacccgttcgagaagaagccg
acccagccgcgctaccacgggcggcaccagctgaaccggtacgccgacgggctcgagaag
tgcatcgggtgcgagctgtgcgcgtgggcctgcccggccgacgcgatctacgtggagggc
gccgacaactcgcccgacgcccagttctccccgggcgagcggtacggccgcgtctaccag
atcaactacctgcggtgcatcttctgcgggctgtgcatcgaggcgtgcccgacccgggcc
ctgacgatgacgaacgacttcgagctcgccggcccgacgcgcgaggggctcatcttcacg
aaggacgagctgctcgcgccgctgcgggagggccagctcgccgcgccgcacccgatggtc
gccggcacggtggacgacgactactaccgcggtgaggtcaccggccccaccaccgaccag
gtcgactgggtcgccgagcagcgccccgacgacccgacgttgcccgccgcccgagcggcc
gcggacgccgaggccaccgccgaacgcgcgaaggccgcccggtga

DBGET integrated database retrieval system