KEGG   Beutenbergia cavernae: Bcav_3221Help
Entry
Bcav_3221         CDS       T00893                                 

Definition
(GenBank) NADH-quinone oxidoreductase, chain I
  KO
K00338  NADH-quinone oxidoreductase subunit I [EC:1.6.5.3]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00190  Oxidative phosphorylation
bcv01100  Metabolic pathways
Module
bcv_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcav_3221
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Bcav_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_10 Fer4_2 Fer4_9 Fer4_6 Fer4_8 Fer4_21 Fer4_3 Fer4_17 Fer4_4 Fer4_18 Fer4_22 Fer4_13 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ACQ81465
UniProt: C5C0R9
Position
complement(3577285..3578049)
Genome map
AA seq 254 aa AA seqDB search
MAEPKKRPATGRPQPKGAAPARRRPAAPPAKRQAPARPEPESGEKGGLGELLAPVAGFGV
TFSSMFRPSMTEQYPFEKKPTQPRYHGRHQLNRYADGLEKCIGCELCAWACPADAIYVEG
ADNSPDAQFSPGERYGRVYQINYLRCIFCGLCIEACPTRALTMTNDFELAGPTREGLIFT
KDELLAPLREGQLAAPHPMVAGTVDDDYYRGEVTGPTTDQVDWVAEQRPDDPTLPAARAA
ADAEATAERAKAAR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgaagaagcggccggcgaccggccgcccgcagccgaagggcgctgcgccg
gcccggcgtcgtcccgcagcgccgcccgcgaagcgccaggcgcccgcgcgacccgagccg
gagtccggcgagaagggcgggctcggggagctcctggcgcccgtcgccgggttcggcgtc
acgttctcgtcgatgttccggccgtcgatgacggagcagtacccgttcgagaagaagccg
acccagccgcgctaccacgggcggcaccagctgaaccggtacgccgacgggctcgagaag
tgcatcgggtgcgagctgtgcgcgtgggcctgcccggccgacgcgatctacgtggagggc
gccgacaactcgcccgacgcccagttctccccgggcgagcggtacggccgcgtctaccag
atcaactacctgcggtgcatcttctgcgggctgtgcatcgaggcgtgcccgacccgggcc
ctgacgatgacgaacgacttcgagctcgccggcccgacgcgcgaggggctcatcttcacg
aaggacgagctgctcgcgccgctgcgggagggccagctcgccgcgccgcacccgatggtc
gccggcacggtggacgacgactactaccgcggtgaggtcaccggccccaccaccgaccag
gtcgactgggtcgccgagcagcgccccgacgacccgacgttgcccgccgcccgagcggcc
gcggacgccgaggccaccgccgaacgcgcgaaggccgcccggtga

DBGET integrated database retrieval system