KEGG   Beutenbergia cavernae: Bcav_3260Help
Entry
Bcav_3260         CDS       T00893                                 

Definition
XRE family transcriptional regulator (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcv  Beutenbergia cavernae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_3260
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcav_3260
Enzymes [BR:bcv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Bcav_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3615273..3616814
Genome map
AA seq 513 aa AA seqDB search
MTVIDDTQTSLAEIGALIRGARQNKGLTQAQLAERLGTSQSAIARIEQGSQNLSVELLTR
INRALEADLLSIGGARASHLRVTGGHQLSGTITVKSSKNGAVALLCASLLNSGRTRLRGV
ARIVEVDRIVDVLRSIGVVVTWSADGRDLDIQPPAKLDLTSIDTDAARRTRSIIMFLGPL
LNREQTFELPYAGGCDLGTRTVEPHMIALRPFGLDVVATAGEYHATVATDRPTDLRVVLT
ERGDTVTENAIMAAARHVGTTTIRNASSNYMVQDLCFYLELLGVRIEGIGTTTLVVHGSP
DIRADVEYAVSEDPVEAMSLLTAGIVTNSEITVARVPVEFMEIELATLAEMGLRYALSPE
YTAANGRTRLVDITVQPSELHAPIDKIHPMPFPGLNIDNLPFFAVIAACASGTTLIHDWV
YDNRAIHLTDLTRLGADVRMLDPHRLDVTGPTHWSGAEISCPPALRPAVVILLAMLAAKG
TSVLRGVDIIARGYEQLQERLIELGAQIETFRD
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgatcgacgacacgcagacctcactcgccgagatcggcgcgctcatccgcggc
gcccgccagaacaagggcctcacgcaggcccagctggctgaacgcctgggcaccagtcag
agcgcgatcgcgcggatcgagcagggcagccagaacctctcggtcgagctcctcacgcgc
atcaaccgcgcgctcgaggccgacctcctgtcgatcggcggcgcccgagcgtcgcacctg
cgcgtgaccggcgggcaccagctgtccggcacgatcaccgtcaagtcctcgaagaacggc
gcggtcgcgctgctgtgcgcgtcgctcctcaactccggtcgcacgcgcctgcgcggcgtc
gcccggatcgtcgaggtggaccgcatcgtcgacgtcctgcgctcgatcggcgtggtcgtc
acctggtccgccgacgggcgcgacctcgacatccagccgccggccaagctcgacctcacg
tcgatcgacacggacgccgcgcgccgcacccgcagcatcatcatgttcctgggccccctg
ctgaaccgggagcagacgttcgagctcccctacgcgggcggctgcgacctcgggacgcgc
accgtcgagccgcacatgatcgcgctgcgcccgttcgggctcgacgtcgtcgcgactgcc
ggcgagtaccacgccaccgtcgccaccgaccggcccaccgacctgcgcgtcgtcctcacc
gagcgtggcgacaccgtcaccgagaacgcgatcatggccgccgcccggcacgtcgggacc
accacgatccgcaacgcgagctcgaactacatggtccaggacctgtgcttctacctcgag
ctcctcggcgtgcggatcgagggcatcgggacgacgacgctcgtggtccacggctcaccc
gacatccgcgcggacgtcgagtacgccgtctccgaggacccggtcgaggcgatgagcctg
ctcaccgccggcatcgtgacgaactcggagatcaccgtggcccgggtgccggtcgagttc
atggagatcgagctggccacgctcgcggagatgggcctgcgctacgccctgtcccccgag
tacaccgccgccaacgggcggacgcggctcgtcgacatcaccgtccagccgagcgagctg
cacgccccgatcgacaagatccacccgatgccgttccccggcctcaacatcgacaacctg
ccgttcttcgccgtcatcgcggcgtgcgcgagcgggacgaccctcatccacgactgggtc
tacgacaaccgggcgatccacctcacggacctcacgcgtctcggcgcggacgtccgcatg
ctcgacccgcaccgcctcgacgtcacgggcccgacgcactggtccggcgcggagatctcg
tgcccgccggcgctgcgccccgccgtcgtcatcctgctcgcgatgctcgccgcgaagggc
acgtccgtgctgcgcggcgtcgacatcatcgcccgcggctacgagcagctgcaggagcgc
ctcatcgagctcggcgcacagatcgagacgttccgcgactga

DBGET integrated database retrieval system