KEGG   Beutenbergia cavernae: Bcav_3291Help
Entry
Bcav_3291         CDS       T00893                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bcv00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3646665..3648182
Genome map
AA seq 505 aa AA seqDB search
MADYVLAIDQGTTSSRAIIFDHSGTIVATGQKEHEQIFPRAGWVEHDPEEIWTNVRDVVG
QALGRASVRASNIAAIGITNQRETAVVWDRTTGKPVYNAIVWQDTRTQRIVEELGGSEGA
EKYKARVGLPLATYFSGPKIKWILDNVDGAREAAERGDLLFGNTDTWVLWNMTGGVNGGV
HVTDVTNASRTMLMDLDTLSWNPDIAADMGIPVSMLPEIRSSSEVYGKDREEGLLAGVPI
AGILGDQQAATFGQACFEIGMAKNTYGTGNFMLMNTGTEQVASENGLLTTVCYKIGDQPQ
VYALEGSIAVTGSLVQWLRDNLKVISTAPEIENLALTVEDNGGAYFVPAFSGLFAPYWRA
DARGALVGLTRYVSLGHIARAALEATAFQSAEVLDAMKADSGVDLTELKVDGGMVANEVL
MQFQADILGVDVVRPKVAETTALGAAYAAGIAVGFWNGEQDVIDNWAEDKRWTPQMDRGD
RDRLYRNWKKAVTKTFDWVDDDVEN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggccgactacgtcctcgctatcgaccagggcacgacgagctcgcgcgccatcatcttc
gaccacagcggcaccatcgtcgcgaccgggcagaaggagcacgagcagatcttcccgagg
gcgggctgggtcgagcacgacccggaggagatctggacgaacgtgcgcgacgtcgtcggc
caggctctcggtcgggcgagcgtccgagcgtcgaacatcgccgcgatcggcatcaccaac
cagcgggagaccgccgtcgtctgggaccgcaccaccggcaagccggtctacaacgcgatc
gtctggcaggacacgcgcacccagaggatcgtcgaggagctcgggggatcggagggcgcg
gagaagtacaaggcgcgggtcggcctgccgctcgcgacgtacttctccggcccgaagatc
aagtggatcctcgacaacgtcgacggcgcccgcgaggcggcggagcgcggcgacctgctg
ttcgggaacacggacacgtgggtgctgtggaacatgaccggcggcgtgaacggcggcgtg
cacgtcaccgacgtcacgaacgcgtcccggacgatgctcatggacctcgacacgctgtcg
tggaaccccgacatcgcggcggacatgggcattccggtgtcgatgctgccggagatcagg
tcgtcctccgaggtgtacggcaaggaccgtgaggaaggactgctcgccggcgtccccatc
gcgggcatcctcggcgaccagcaggcggccacgttcggccaggcgtgcttcgagatcggc
atggccaagaacacgtacggcaccggcaacttcatgctcatgaacacgggcacggagcag
gtggcgagcgagaacggcctcctgacgaccgtctgctacaagatcggcgaccagccgcag
gtgtacgcgctcgagggatcgatcgccgtcaccggctcgctcgtgcagtggctgcgcgac
aacctcaaggtcatcagcacggcgcccgagatcgagaacctcgcgctgaccgtggaggac
aacggcggcgcctacttcgtgccggcgttctccgggctgttcgcgccgtactggcgagcg
gacgcgcgcggtgctctggtgggtctcacgcggtacgtctcgctcgggcacatcgcccgc
gcggcgctggaggcgacggcgttccagtccgcggaggtgctcgacgcgatgaaggcggac
tccggcgtcgatctcacggagctcaaggtcgacggcggcatggtggccaacgaggtcctc
atgcagttccaggcggacatcctcggcgtcgacgtcgtgcggccgaaggtcgcggagacg
acggcgctcggcgccgcctacgccgcggggatcgccgtcgggttctggaacggcgagcag
gacgtcatcgacaactgggccgaggacaagcgctggacgccgcagatggaccgtggcgac
cgggaccggctgtaccggaactggaagaaggcggtcacgaagacgttcgactgggtggac
gacgacgtcgagaactga

DBGET integrated database retrieval system