KEGG   Beutenbergia cavernae: Bcav_3322Help
Entry
Bcav_3322         CDS       T00893                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcv  Beutenbergia cavernae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bcv00001]
   00052 Galactose metabolism
    Bcav_3322
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bcav_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3681062..3683182)
Genome map
AA seq 706 aa AA seqDB search
MILPSTRRIPYGGDYNPEQWPEEVWAEDDAAFDLAHIDTLTVGVFAWSLTQPREDVYDLD
LLAQILDRAHAQGRQVCLATGTGALPPWLARAYPEVCRTDFEGRRHVYGQRHNACPSSPA
YRRLAAALAGAVAARFADHPALLAWHVNNEYGGACYCDLCAAEFRAWLRQHHGSLDALND
AWNATFWSHRFTAWEEIVPPNALSEHWRGPDHTAFQGITLDYLRFTSDNLLRTFREEKAA
IREHSDAPVTTNFMGMYRPIDYHRWADDLDVVSWDNYPPDERSASRMALAHDLMRGLKGG
QPFWLMEQTPTVTASRDVNPLKRPGVMRLWSWQAVAHGGDAVLFFQMRQSRGACEKYHGA
VLNHAGRTDTRSFREVAALGEELERLGDALLGGRTPARVALLFDWDSWWAVEISDGPNRH
VRYPAVLVDYHRALWEAGAQLDVVPVTADLTGYDVVVAPLLHMVKGDLASRLEAVVARGG
SVVTTVLSGRVDEAANAFLSDVPGPLARLLGVRVDETDARPPAAANSVTLTEDDGAARLV
SDGTLVFDLVIPDGADVVGTYGADFYAGSPAVTRNTFGDGEAWYVGTMLDGDGVAWVVRR
VLARHGLLGPYADAPGVEHAVRQVDGTTYDLVLHHGDEAVEVVAHAGGTDLLTGGRIEHG
ATLTLEPTDVVVLARDDADAASMPTPAGTVEASDPAAAGQGRAGRT
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgccgagcacacgccggatcccgtacggcggcgactacaaccccgagcagtgg
cccgaggaggtctgggccgaggacgacgcggccttcgacctcgcgcacatcgacaccctc
acggtcggcgtcttcgcctggtcgctgacccagccgcgcgaggacgtctacgacctcgat
ctcctcgcgcagatcctcgaccgtgcgcacgcgcagggccgccaggtctgcctcgccacc
ggcaccggagccctgcccccgtggctcgcgcgcgcctacccggaggtctgccgcaccgac
ttcgagggccggcgccacgtctacggtcagcgccacaacgcctgccccagctcacccgcc
taccgccgcctggccgcggcactggcgggcgccgtcgccgcgcggttcgcggaccacccc
gccctgctcgcctggcacgtcaacaacgagtacggcggcgcctgctactgcgacctgtgc
gccgccgagttccgggcctggctgcgtcagcaccacggcagcctggacgcgctgaacgac
gcctggaacgccaccttctggtcccaccgcttcaccgcgtgggaggagatcgtgccgccg
aacgcgctgtcggagcactggcgcggccccgaccacacggcgttccagggcattacgctc
gactacctgcgcttcacctccgacaacctcctgcgcacgttccgcgaggagaaggcggcg
atccgggagcactccgacgcccccgtcaccacgaacttcatgggcatgtaccgcccgatc
gactaccaccggtgggccgacgacctcgacgtcgtctcgtgggacaactacccgcccgac
gagcgctcggcctcgcgcatggccctcgcccacgacctcatgcgcgggctcaagggcggg
cagccgttctggctcatggagcagaccccgaccgtcaccgcgagccgcgacgtgaacccg
ctgaaacggcccggcgtcatgcgcctgtggtcgtggcaggccgtcgcccacggcggcgac
gccgtcctgttcttccagatgcgccagagccgcggcgcgtgcgagaagtaccacggcgcc
gtcctcaatcacgccggccgcacggacacccgctccttccgcgaggtcgcggcgctcggc
gaggagctcgagcggctcggcgacgccctcctcggcggccgtacaccggcccgggtcgcg
ctgctgttcgactgggactcctggtgggccgtcgagatctccgacggcccgaaccggcac
gtgcggtacccggccgtgctggtcgactaccaccgcgcgctctgggaggcgggcgctcag
ctcgacgtcgtcccggtgaccgccgacctcacgggctacgacgtcgtcgtcgccccgctg
ctgcacatggtcaagggcgacctcgcctcgcggctcgaggccgtcgtcgcccgcggcggc
agcgtcgtgacgaccgtgctgtccggccgcgtggacgaggccgccaacgcgttcctctcc
gacgtccctggcccgctcgcccgcctgctcggcgtccgggtggacgagaccgacgcccgg
cctcccgccgcggcgaactccgtgacgttgacggaggacgacggcgcggcccgcctggtc
tcggacggcaccctggtcttcgacctcgtcatcccggacggcgccgacgtggtcggcacg
tacggtgcggacttctacgccgggtcgccggcggtcacgcggaacaccttcggcgacggc
gaggcgtggtacgtcggcacgatgctcgacggcgacggcgtcgcctgggtcgtgcgccgc
gtgctcgcgcgtcacgggctcctgggtccgtacgccgacgcgccgggcgtcgagcacgcg
gtccgccaggtcgacgggaccacgtacgacctggtgctgcaccacggggacgaggcggtc
gaggtcgtcgcgcacgccggcggcaccgacctgctgacgggaggccgcatcgagcacggg
gcgaccctgacgctcgagccgaccgacgtcgtcgtcctcgcccgcgacgatgccgacgca
gcgtcgatgccgacgccggccggtaccgtcgaggcgtctgacccagcagcagcgggccag
gggcgggccggaaggacgtga

DBGET integrated database retrieval system