KEGG   Beutenbergia cavernae: Bcav_3663Help
Entry
Bcav_3663         CDS       T00893                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcav_3663
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_3663
  Lipid metabolism
   00071 Fatty acid degradation
    Bcav_3663
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcav_3663
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcav_3663
   00626 Naphthalene degradation
    Bcav_3663
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcav_3663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4076441..4077487
Genome map
AA seq 348 aa AA seqDB search
MRAVVVDAFGAPPHVREVPDPTCPPHGVVVDVRATGVCRSDWHAWAGHDDDVRVPYVPGH
ELAGVVTQVGPDVQGWRGGERVTVPFVCACGTCSACAAGEHQVCERQEQPGFTYDGSFAE
RVAVPWADVNLVALPDAVSDDAAALLGCRFATAYRAVRTHARVGAGESLVVHGCGGVGLA
AVMVGVAGGARVVAVDPSPDARAAAEALGAGAALDPAGMTPDGVASAVVDLTGGGARASI
DAVGHPDVARASVLSLARRGRHVQAGLLLGDAAAAPMAMDRVIAWELELYGSHGMAAHDY
PAMLAEIASGALDPARLVGAVVGLDDAAGALVAMGGEPEHAGVTIVRP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccgtcgtcgtcgacgcgttcggcgctcccccgcacgtgcgcgaggtgccggac
ccgacgtgcccgccgcacggcgtcgtcgtcgacgtgcgcgcgacgggcgtgtgccgcagc
gactggcacgcgtgggccgggcacgacgacgacgtccgcgtcccgtacgtgccggggcac
gagctcgcgggcgtcgtgacgcaggtcggcccggacgtgcagggctggcgcggcggggag
cgggtcacggtgccgttcgtgtgcgcgtgcgggacgtgctcggcgtgcgcggccggcgag
caccaggtgtgcgaacgccaggagcagccgggtttcacgtacgacgggtcgttcgccgag
cgggtggcggtgccgtgggcggacgtcaacctggtcgcgctgccggacgccgtgtccgac
gacgccgctgctcttctcgggtgccggttcgcgacggcgtaccgcgcggtgcgcacccat
gcccgggtcggcgccggcgagtcgctggtcgtgcacgggtgcggcggcgtcgggctcgcg
gcggtgatggtcggcgtcgcgggcggggcgcgcgtggtcgccgtcgacccgtcaccggac
gcccgggcggcggccgaggcgctcggcgccggcgccgcgctcgatccagcggggatgacg
ccggacggcgtcgcctccgccgtcgtcgacctcaccggaggcggtgcgcgggcctcgatc
gacgccgtcggccaccccgacgtcgctcgcgcgtcggtgctctcgctcgcccgccgcggg
cggcacgtgcaggcgggcctgctcctcggcgacgccgccgccgcgccgatggccatggac
cgcgtcatcgcgtgggagctcgagctctacggctcgcacggcatggcggcccacgactac
ccggcgatgctcgccgagatcgcgtccggcgcgctcgacccggcgcggctcgtgggcgcc
gtcgtcggcctggacgacgccgccggggcactcgtcgccatgggcggagagccggagcat
gccggggtgaccatcgtcaggccgtag

DBGET integrated database retrieval system