KEGG   Beutenbergia cavernae: Bcav_3777Help
Entry
Bcav_3777         CDS       T00893                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bcv  Beutenbergia cavernae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_3777
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bcav_3777
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcav_3777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4191189..4192415
Genome map
AA seq 408 aa AA seqDB search
MRPIRSHARTDRRARRAARVPAIATTAALLLVTAACTSPASGPTPEPSPTATTSPTPSAT
PTPSPTADPLADLSLEQRVGQLFMVGTDAATAEQVTLDAITASHVGNVFLAGRSNAGVDA
TAAVVEQLTAAVTDEATGGVPLLVATDQEGGNVQVLRGPGFSDIPTALDQGALDPATLQA
DATTWGAELAASGINLNLAPVMDVVASPEAAAANPPIGYFHREFGYDAETVASHANAFSA
GMRASGVETVIKHFPGLGRVTENTDTTAGVVDDVTTADDASVQAFAAGIDAGAAFVMTST
AVYSQIDPDAPAAFSREIVSDLLRGQLGFDGVVVTDDVSAAEQVQAWSPADRAILAIEAG
TDIVLVSADPSIAAEMVAAVVAKAQADPDFAAIVDDAARRVLAAKGVA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccatccgctcgcacgcccgcaccgaccgcagggcccgccgcgccgcgcgggtg
ccggccatcgccacgaccgccgccctgctcctggtcaccgcggcgtgcacctcgcccgcg
agcggacccacgcccgagccgagccccaccgccacgaccagcccgacgccgtcggccacg
cccaccccgagcccgacggccgacccgctcgccgacctcagcctcgagcagcgcgtgggg
cagctcttcatggtcggcacggacgccgcgaccgccgagcaggtgaccctcgacgcgatc
acggcctcgcacgtcggcaacgtgttcctcgccggccgctccaacgctggtgtggacgcg
acggccgccgtcgtcgagcagctgaccgccgccgtgaccgacgaggcgaccggcggcgtc
ccactcctcgtcgccaccgaccaagagggcggcaacgtgcaggtcctgcgcgggccgggc
ttctccgacatccccacggcgctcgaccagggcgctctcgacccggccacgctccaggcc
gacgccaccacgtggggagccgagctcgccgcatcgggcatcaacctcaacctcgccccg
gtcatggacgtcgtcgcgagccccgaggccgcggcggcgaacccgccgatcgggtacttc
caccgggagttcggctacgacgccgagaccgtcgcctcgcatgcgaacgccttcagcgcc
ggcatgcgcgcctccggcgtcgagaccgtcatcaagcacttccccgggctgggccgggtc
acggagaacaccgacaccaccgccggtgtcgtcgacgacgtcacgaccgccgacgacgcc
agcgtccaggcgttcgccgccggcatcgacgccggcgccgccttcgtcatgacgtcgacg
gcggtgtacagccagatcgacccggacgcgccggcggcgttctcccgggagatcgtgagc
gacctgctgcgcggccagctcggcttcgacggcgtcgtggtcaccgacgacgtctccgcc
gccgagcaggtccaggcgtggtcgcccgccgaccgggccatcctcgcgatcgaggccggg
accgacatcgtgctcgtgtccgccgacccgagcatcgccgccgagatggtggccgccgtc
gtcgcgaaggcgcaggccgatcccgacttcgccgccatcgtcgacgacgccgcgcgccgc
gtcctcgccgcgaagggtgtggcgtag

DBGET integrated database retrieval system