KEGG   Beutenbergia cavernae: Bcav_3965Help
Entry
Bcav_3965         CDS       T00893                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00010  Glycolysis / Gluconeogenesis
bcv00020  Citrate cycle (TCA cycle)
bcv00620  Pyruvate metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
Module
bcv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_3965
   00020 Citrate cycle (TCA cycle)
    Bcav_3965
   00620 Pyruvate metabolism
    Bcav_3965
Enzymes [BR:bcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcav_3965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACQ82206
UniProt: C5C566
Position
complement(4384677..4386212)
Genome map
AA seq 511 aa AA seqDB search
MPKFQQFALPDVGEGLTEADIVTWHVAVGDTVSVNQTIVEIETAKSLVELPCPWDGVVTR
LLVEPGQTVDVGTPIVVVDVDPAGPADAADPAPADASAAAPAASAASEGSEASSEGSGDV
LVGYGTRPAASARRPRTTGGAASGGTTATAASGRTTATAASGAASGGPAAGSDARPTPGL
RAVPAVGGAPTRPPAVVTPPASAATPSSSTHLVLAKPPVRKLAKDLGIDLTTVTPSGPGG
IVTRGDVLARSQGNEPRQLATYPGDDKPWLADGSVSDDGRQTRVPVRSVRRRTAEAMVAS
AFTAPHVTVFRTVDVSRTMELVAQLRSDREFEDVRVTPLLITAKALILAIRRHPEISASW
DDETQEIVYKHYINLGIAAATRRGLVVPNIKDAHRLTLHELAGEIAALTQTAREGKTTPV
GMSDGTATITNIGVFGIDAGTPILNPGESAILALGAIEQRPWVHDGELAVRWVTQLALSF
DHRLVDGELGSRVLADVARVLEDPARGLVWG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaagttccagcagttcgcccttcccgacgtcggcgagggcctcacggaggccgac
atcgtcacctggcacgtcgccgtcggggacacggtctccgtcaaccagacgatcgtcgag
atcgagacggcgaagtccctcgtcgagctgccgtgcccgtgggacggcgtcgtgacgcgg
ctgctcgtcgagcccgggcagacggtcgacgtcggcactcccatcgtcgtcgtggacgtg
gaccccgccggccccgcggacgccgcggatcccgcgccggccgacgcctcggcggctgcg
cctgcggcatcggcggcatccgaggggtccgaggcgtcgtcggaggggagcggcgacgtg
ctcgtcgggtacggcacacgcccggccgcctccgcgcggcgtccgcgcacgacgggcggt
gcggcgtcgggagggacgacggcgaccgcggcatcgggacggacgacggcgaccgcggcg
tcgggtgcggcgtccggcggcccggcggccggctcggacgcgcggccgacgcccggcctg
cgtgccgtccccgccgtgggcggcgcaccgacccgacccccagccgtggtgacgcctcct
gcgtccgccgcgacgccgtcgtcatccacgcatctggtgctcgcgaagccgccggtccgc
aagctcgcgaaggacctcggcatcgacctgacgaccgtgacgccgtccggaccgggcggc
atcgtcacgcgcggcgacgtgctggcgcggtcgcagggcaacgagccgcgtcagctcgcg
acctaccccggcgacgacaagccgtggctcgcggacggctccgtgtccgacgacggccgc
cagacccgcgtcccggtgcggtcagtacggcgccggacggcggaggcgatggtcgcctcc
gcgttcaccgcgccgcacgtgacggtgttccggaccgtcgacgtgagccgcacgatggag
ctcgtcgcccagctgcgctcggaccgcgagttcgaggacgtgcgggtcacaccgctgctc
atcacggcgaaggcgctgatcctcgcgatccggcggcacccggagatcagcgcgtcctgg
gacgacgagacccaggagatcgtctacaagcactacatcaacctcgggatcgcggcggcg
acgcggcgcgggctggtcgtgcccaacatcaaggacgcccaccggctgacgctccacgag
ctcgccggcgagatcgcggcgctcacccagaccgcccgcgaggggaagaccacgccggtc
gggatgagcgacggcacggcgaccatcacgaacatcggcgtgttcgggatcgacgccggg
acgccgatcctcaacccgggcgagtccgcgatcctcgcgctgggcgccatcgagcagcgg
ccctgggtgcacgacggcgagctcgccgtgcgctgggtgacgcagctcgcgctgtcgttc
gaccaccggctcgtcgacggcgagctcggctcgcgggtgctggccgacgtcgcccgtgtg
ctcgaggacccggcgcgcggcctcgtctggggctga

DBGET integrated database retrieval system