KEGG   Beutenbergia cavernae: Bcav_3986Help
Entry
Bcav_3986         CDS       T00893                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bcv  Beutenbergia cavernae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcv00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bcv00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bcv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4409245..4410816
Genome map
AA seq 523 aa AA seqDB search
MPAPTSTLARRSFLTIAGVASSGAVVAAAAPAVAAPAGPVPRDPLFTLGVASGDPHPDGV
VLWTRLAPDPLATDGRGGMPDRVVPVTWEVAEDERFRRIVRRGVEHASAAWAHSVHAEVH
GLRPDHTYWYRFRANGQASPAGRTRTAPAPGARLRELRFAFASCQNYSVGFFTALRHLAH
EDVDFLVHLGDYIYEGDAAGDIGRAHLPAVELYSLTDYRLRYSQYKLDADLQAAHHAHPW
IVAPDDHDLENNWAGDHSEPDDEPDQDPAVFRQRRAAAYQAYWENLPLRRSSMPRGPEMQ
VFRRLVFGDMLQLDVLDTRRFRDPQVTDQADRWNPERQILGPEQEAWLLAGLGAATARWK
VLGSQVFMFDADTVTGPGERYGTDPWPGYAAARQRLFDGLAERDVDNFVVLSGDAHRSAA
ADLKLSFADEGSPTVGTEFLGTSLTSGKDGSDMDGTGTVWLAENPHLRFHNAQRGYQVCR
LGRDEMHTEYRIVPYVTSPGAPITTRATVFVESGRPGVAHVSD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgccagcaccgacgtccaccctcgcccgccgttccttcctgacgatcgccggggtcgcc
tcgagcggcgccgtcgtcgccgccgcggcgcccgccgtcgccgctcccgccgggcccgtg
ccgcgtgacccgctcttcacgctcggggtcgcctccggcgacccgcacccggacggcgtc
gtgctctggacccggctcgcccccgacccgctcgcgaccgacggccgcggaggcatgccc
gaccgcgtcgtccccgtcacgtgggaggtggccgaggacgagcggttccgccggatcgtg
cgccggggggtcgagcacgccagcgccgcgtgggctcacagcgtccacgccgaggtgcac
ggactgagaccggaccacacgtactggtaccggttccgcgccaacggccaggcgagcccc
gcgggccggacacggacagctcccgcgcccggggcgcgcctgcgcgagctcaggttcgcg
ttcgcgagctgccagaactactcggtcggcttcttcacggcgctgcgacacctggcccac
gaggacgtcgacttcctcgtgcacctcggtgactacatctacgagggggacgcggcaggc
gacatcggccgcgcccacctcccggcggtggagctctactcgctgaccgactaccgcctc
cggtactcccagtacaagctcgacgccgaccttcaggcggcccaccacgcccacccgtgg
atcgtcgcgcccgacgaccacgacctggagaacaactgggcgggcgaccactcggagccg
gacgacgaaccggaccaggacccggcagtcttccggcagcggcgcgccgccgcgtaccag
gcgtactgggagaaccttccgcttcgccgctcctccatgccccgaggtccggagatgcag
gtcttccggcggctcgtgttcggcgacatgctgcagctcgacgtgctcgacacccggcgc
ttccgggatccgcaggtcacggatcaggccgaccggtggaaccccgagcgccagatcctc
ggtccggagcaggaggcgtggctgctggccggtctcggggctgccacagcgcgctggaag
gtgctgggcagccaggtcttcatgttcgacgccgacacggtcacgggtccgggcgagcgg
tacggcaccgatccgtggcccgggtacgccgccgcccgccagcgtctgttcgacggtctg
gcagagcgcgacgtcgacaacttcgtcgtgctctccggcgacgcacaccggagcgcggcg
gcggacctcaagctcagcttcgcggacgagggctcgccgacagtcggcacggagttcctc
ggcacgtcgttgacgtcgggcaaggacggatccgacatggacggcaccggcaccgtgtgg
ctggcggagaatcctcacctgcgcttccacaatgcgcagcggggataccaggtgtgccgg
ctcgggagggacgagatgcacacggagtaccgcatcgtcccctacgtcacgagcccgggc
gccccgatcacgacgcgagcgacggtgttcgtcgagtcggggcgccccggcgtcgcgcac
gtcagcgactga

DBGET integrated database retrieval system