KEGG   Beutenbergia cavernae: Bcav_4013Help
Entry
Bcav_4013         CDS       T00893                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bcv  Beutenbergia cavernae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4437888..4439255
Genome map
AA seq 455 aa AA seqDB search
MEYVLGTRGTLVSERSLTGRTVLVPRTDPDDAIVRAVEDAGAHVLRAELLAFVPPDDVAP
LDAALGRLAAGDYDWLAVTSPRTVDALVAAARRGAAGGSRGAGAPEAGSPVVGPLGAAEP
AARTLGGPEPAARTLAATEPVVHTLGGPEPAARTLAAALGATRVAAVGPATAAALDAAGV
PVHLVPGDRAPSSAAGLVAAWPAAPTTEVAPGGRGSGPHPLPHPPATTSARGLRLEGDPD
APEPETRVLLPQSARAEPTLAEGLAAKGWDVDAVTAYRTVPGTPPGPEIARAWTAGEVDA
VVLTSGSAAEHLLALLGPPPAATRVCAIGDVTAAAASRLGIPVAVTADQPTPSAIVAALA
HALSAPPFAPAPPTPARPPAPAPAPAPSPAPAPAPAPAPSAVGAVSGARERSHGPEPAPT
TEGGHASGFEPQPQPEPEPQPEPEPRRRPLPKDPS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtggagtacgtgctcggcacccggggcacgctcgtgagcgagcgctcactcaccggacgg
accgtgctcgtgcctcgcacggaccccgacgacgcgatcgtccgcgccgtcgaggacgcc
ggcgcgcacgtgctgcgggccgagctcctcgcgttcgtcccgcccgacgacgtcgcgccg
ctcgacgccgcgctcggtcgcctggctgccggcgactacgactggctggccgtgacgagc
ccccgcaccgtcgacgcgctcgtcgcagctgcccggcgcggagcggctggaggctcgcgc
ggcgcaggtgcgccggaggccggctcaccggtcgtgggcccgttgggggcggctgagcct
gccgcgcgcacgttggggggacctgagcctgccgcgcgcacgctggcggcgactgagcca
gtcgtgcacaccttggggggacctgagcctgccgcgcgcacactggcggcggcgctcggc
gcgacgcgcgtggcggcggtcggcccggccacagcggcggcgctcgacgccgccggcgtc
ccggtgcacctcgtcccgggcgaccgcgcgccgtcgtcggcggccggcctcgtcgccgcg
tggcccgcggctcccaccaccgaggtagcaccgggcgggcgaggtagtggtccgcaccca
ctacctcacccgcccgctactacctcggcgagaggtctccggctcgagggcgacccggat
gcccccgagccggagacgcgcgtcctgctgccgcagtcggcgcgcgccgagccgacgctc
gccgaaggcctggccgcgaaaggctgggacgtcgacgccgtcaccgcctaccgcacggtg
cccggcactccgcccggacccgagatcgcccgcgcctggacggctggcgaggtcgacgcc
gtcgtcctcacgtcggggagcgccgccgagcacctgctggcgctgctcggcccgccaccc
gccgccacgcgggtgtgtgcgatcggggacgtgacggcggccgcggcgtcgcggctcggc
atcccggtcgccgtgacggctgaccagcccacgccgtccgcgatcgtcgccgcgctggcc
cacgcgctcagcgcacccccgttcgcacccgctccccccacccccgcacgtccgcccgca
cccgcacccgcacccgcaccgtcgcccgcacccgcacccgcacccgcacccgcaccttcg
gctgtgggtgcggtttccggggctcgtgaacgctcacacggcccggaacccgcacccaca
accgagggcgggcacgccagcgggttcgagccccagccccagcccgagcccgagccccag
cccgagcccgagccgcgtcgtcgacccctcccgaaggatccgtcatga

DBGET integrated database retrieval system