KEGG   Beutenbergia cavernae: Bcav_4014Help
Entry
Bcav_4014         CDS       T00893                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bcv  Beutenbergia cavernae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcav_4014
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bcav_4014
Exosome [BR:bcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcav_4014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4439252..4440262
Genome map
AA seq 336 aa AA seqDB search
MTVLPPGSPRPRRLRATPALRRLTAEHRLDARDLVLPLFLREGASEAVPIASMPGVVQHS
RDSLRAEVVRAAEAGIGGVMLFGVPTTRDAEGSGADDPDGVLNTGIRDAIAEVGDAVVVM
ADLCLDEFTDHGHCGVLDGAGRVDNDATLERYAAMALAQADGGAHVLGLSGMMDGQVGHV
RAALDDAGRADTALLAYSAKYASAFYGPFRDAVESRLVGDRRAYQLDPANRREGLRETLL
DLAEGADAVMVKPALAYLDVLADVASASDVPVWAYQVSGEYAMVEAAAANGWIDRERAVR
ETLLSIVRAGADAVLTYWALDVAGWLRADGGAGGAR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctgcctcccggcagccctcgcccgcggcgcctgcgcgcgacgccggccctg
cgccgcctcacggcggagcaccgcctcgacgcccgcgacctcgtgctcccgctcttcctc
cgagagggcgcgagcgaggccgtcccgatcgcgtcgatgcccggcgtcgtccagcactcc
cgcgactcgctgcgcgccgaggtggtacgcgccgcggaggccggcatcggtggcgtcatg
ctgttcggcgtcccgacgacgcgcgacgccgagggctccggcgccgacgaccccgacggc
gtgctgaacacgggcatccgcgacgcgatcgcggaggtgggggacgccgtcgtcgtcatg
gcggacctgtgcctcgacgagttcaccgaccacgggcactgcggcgtgctcgacggcgcc
gggcgggtcgacaacgacgccaccctcgagcggtatgccgcgatggcgctcgcgcaggca
gacggcggcgcccacgtgctggggctcagcgggatgatggacggccaggtgggccacgtg
cgggcggcgctcgacgacgccggccgcgccgacaccgcgctcctcgcctactccgcgaag
tacgcgagcgcgttctacgggccgttccgggacgccgtcgagtcgaggctcgtcggggac
cggcgcgcgtaccagctcgacccggcgaaccgccgcgaaggcctgcgcgagaccctgctc
gacctggccgagggcgcggacgccgtcatggtcaagcccgcgctcgcctacctcgacgtg
ctcgccgacgtggcctccgccagcgacgtgcccgtgtgggcgtaccaggtgagcggcgag
tacgcgatggtcgaggcggccgccgcgaacggctggatcgaccgggagcgtgccgtgcgc
gagacgctgctgtccatcgtgcgggccggcgcggacgcggtcctcacgtactgggcgctc
gacgtcgccggctggctgcgcgcggacggcggcgcgggaggtgcccggtga

DBGET integrated database retrieval system