KEGG   Beutenbergia cavernae: Bcav_4018Help
Entry
Bcav_4018         CDS       T00893                                 

Definition
ATPase P
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
bcv  Beutenbergia cavernae
Brite
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Bcav_4018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4445298..4447631)
Genome map
AA seq 777 aa AA seqDB search
MAAASFQSAPGVIELEVGGMTCASCAMRIEKKLNRLDGVEATVNYATEKATVTAPEGYDP
QLLIAEVEKTGYTAQVPVPPSSATADDDDADRPDPELTSLRQRLVGAVVLSVPVIVLAMV
PAWQFTYWQWASLALAAPVALWSAWPFHRAAWLNLRHGAATMDTLVSVGVLAAFGWSLYA
LFLGTAGEPGMTHGFELTVGRSDGAANIYLEVASGVTMFVLAGRYFEKRSKRQAGAALRA
LLQLGAQEVAVLRGGAETRIPIDQLVVGDEFVVRPGEKIATDGVVVAGASAVDESMLTGE
SVPIEVTEGDAVVGATVNAGGRLVVRATRVGSDTQLAQMARLVEAAQSGKAEVQRLADRI
SGVFVPIVVAIAVGTLGVWLGGGFPATAAFTAAVAVLIIACPCALGLATPTALLVGTGRG
AQLGILIKGPEVLESTRRVDTIVLDKTGTVTTGRMTLTAVVADDGVDRTELLRLAGGLEH
ASEHPIARAIASAAADEVGELPTPDGFTNLGGLGVRGTVEGRAVVVGRASLVAGSGRATG
GAEGTSDDGGTTPEADLPPALAAAQASAERDGRTAVVVGWDGAARGVLVVADAVKPTSAE
AVRQFRILGLTPVLLTGDHRAVAEQVAAEVGIERVIAEVLPEGKVEAVAALQAEGRVVAM
VGDGVNDAAALAQADLGLAMGTGTDVAIEAADLTLVRGDLRAAADAIRLSRRTLGTIKGN
LFWAFAYNTAAIPLAALGLLSPMLAGAAMAFSSVFVVGNSLRLRSFASRATDGAGAR
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgtccttccagagcgcacccggcgtgatcgagctcgaggtcggcggcatg
acgtgcgcgtcgtgcgcgatgcggatcgagaagaagctcaaccggctcgacggcgtcgag
gccacggtgaactacgcgacggagaaggccacggtcacggcccccgagggctacgacccg
cagctgctcatcgcggaggtcgagaagacggggtacacggcgcaggttccggtgccgccg
tcgtccgccacggcggatgacgacgacgccgaccggcccgacccggagctgacctcgctc
cggcagcgactcgtcggcgccgtcgtcctctcggtgccggtgatcgtgctcgcgatggtg
ccggcgtggcagttcacgtactggcagtgggcgtcgctggcgctggccgcgcccgtggcg
ctgtggtcggcgtggccgttccaccgggccgcgtggctgaacctgcggcacggtgcggcg
acgatggacacgctcgtgtcggtcggtgtgctcgccgcgttcggctggtccctgtacgcc
ctgttcctcgggacggccggcgagcccggcatgacgcacggtttcgagctcaccgtgggc
cggagcgacggcgccgccaacatctacctcgaggtcgcctcgggcgtcacgatgttcgtg
ctggcgggccgctacttcgagaagcggtccaagcggcaggcgggggcggcgctccgggcc
ctcctgcagctcggcgcacaggaggtcgccgtgctgcgcggcggcgccgagacgcgcatc
cccatcgaccagctcgtggtgggcgacgagttcgtcgtccgcccgggggagaagatcgcg
acggacggcgtggtggtcgccggcgcgtcggcggtcgacgagtcgatgctcaccggcgag
tccgtgccgatcgaggtcacggagggcgacgccgtcgtcggcgcgacggtcaacgccggc
gggcggctcgtcgtgcgggccacgcgggtgggctcggacacgcagctcgcccagatggcg
cggctcgtcgaggcggcccagtcgggcaaggccgaagtgcagcgactcgctgaccgcatc
tccggggtcttcgtgccgatcgtcgtggcgatcgccgtcggcacgctcggcgtgtggctc
ggcggcggcttcccggccaccgcggcgttcacggccgccgtcgccgtgctcatcatcgcc
tgcccgtgcgcgctgggcctcgcgacgccgacggcgctgctcgtcgggacggggcgcggc
gcccagctggggatcctcatcaagggcccggaggtgctcgagtccacgcggcgcgtcgac
acgatcgtgctcgacaagaccggcacggtgaccaccgggcgcatgacgctcaccgccgtc
gtggcggacgacggcgtcgaccgcaccgagctgctccgcctcgcgggcgggctcgagcac
gcctccgagcaccccatcgcgcgggcgatcgcgtcagccgcggccgacgaggtcggggag
ctgccgacgcccgacggcttcaccaacctcggcgggctcggggtgcgcggaaccgtggag
gggcgtgcggtcgtggtgggtcgcgcgtcgctcgtcgcgggttccggacgcgcgaccggc
ggtgctgagggtacgtccgacgacggcgggacgacgccggaggccgacctcccgcccgcg
ctcgccgcggcccaggcgagcgccgagcgcgacggacgcaccgccgtcgtcgtcggatgg
gacggcgcggcccgcggtgtcctggtcgtggccgacgccgtgaagccgacgagcgctgag
gccgtgcgccagttccgcatcctcgggctgacgcctgtgctgctcaccggcgaccaccgt
gcggtggcggagcaggttgccgcggaggtcgggatcgagcgcgtgatcgcggaggtcctg
ccggagggcaaggtcgaggcggtggcggcgctccaggccgagggtcgggtggtcgcgatg
gtcggtgacggtgtcaacgacgccgcggcgctcgctcaggccgacctcggcctcgccatg
ggcacgggcaccgacgtggcgatcgaggcggccgacctcacgctcgtgcgcggcgacctc
cgcgccgcggccgacgccatccggctctcgcgccgcacgctcgggaccatcaagggcaac
ctgttctgggcgttcgcgtacaacaccgcggcgatcccgctcgcggcgctcgggttgctg
agcccgatgctcgccggggcagcgatggcgttctccagcgtgttcgtggtgggcaacagc
ctgcggctgcggtccttcgcgtcgcgtgcgaccgacggcgccggcgcccgctga

DBGET integrated database retrieval system