KEGG   Borrelia crocidurae: Q7M_1143Help
Entry
Q7M_1143          CDS       T02051                                 

Definition
Pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bcw  Borrelia crocidurae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bcw00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed9:168731..169345
Genome map
AA seq 204 aa AA seqDB search
MKSAFFHLVLNNSALILVDIQNDFLPSGALPVPDGKDIIPLVNKLQNCFKHVIATKDWHP
ENHISFLSETNVNGWPKHCVQNTWGAAFPEDLDVEKIKAIFLKGQDQNYDSYSGFYDDCN
KKNPTGLLKHLKNNKICVVFIAGLALDFCVKETLIDAHNLGFKTYLIIDATKSISDFPEL
IIIELKKLGILTCFSKDILINCDL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgcattctttcatttagttttgaataattctgcattaatacttgtagatatt
caaaatgattttttgccatcaggagcacttcctgttcctgatggtaaggatattattcct
ttagtaaataaacttcaaaattgttttaagcatgttattgcaactaaggattggcatcct
gagaatcatataagttttttaagtgaaactaatgttaatggttggcctaaacattgtgtt
caaaatacatggggagcagcatttccagaagatttagacgttgaaaaaatcaaagctatt
tttttaaaaggacaggatcaaaattatgatagttatagtggattttatgatgattgtaat
aaaaagaatcctacggggcttttaaaacatcttaagaacaataaaatttgtgtggtgttt
atagctggtttggcattggatttttgtgtaaaggaaactcttattgacgctcataatttg
ggatttaaaacttatttgataattgatgctacaaaaagcatttctgattttcctgaattg
ataattatagagcttaagaagcttggaatattgacctgtttttcaaaagatattttgatt
aattgtgatttatga

DBGET integrated database retrieval system