KEGG   Borrelia crocidurae: Q7M_201Help
Entry
Q7M_201           CDS       T02051                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bcw  Borrelia crocidurae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bcw00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bcw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(203158..204366)
Genome map
AA seq 402 aa AA seqDB search
MMSLQKKLKIIGVTGTDGKSSVCFYIYTLLKSMGAKVGFISTVFLEDGSGTLVKNPYRQS
TPESTEIHLVLSKMVANNVEYAIIESTSHGLDDRTSRLLDIEYSVAVLTNISHEHLEFHG
TMQNYLRAKLNLFYSANSHGGFGIINMDDNHFSVFMNSINRTYTYSLKNEKADFFISKIN
EQMGFTEFEFYHNKIKYAARVNLTGSFNVENVMAALIVVSQVMNVDISKLIYKLVNIESL
YGRMQDINFGQDFSLIVDYAHTPGAFLKMFPIFKRLAKKRLISVFGSAGERDILKRRLQG
EIADEYSDVIILCDEDPRGEDSMQIIRDIAEGIVTKTLNKDLFFIPDRKCAIEKAINIAC
GDDLVVTLGKGHESSIIYKDKSIFWDEQAVIKDIILSLGNRG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccttcaaaaaaaacttaaaattattggtgttacaggaactgatggtaagagt
tctgtttgtttttatatttatactttattaaaatctatgggtgctaaagttgggtttatc
tcaacagtgtttcttgaagatggaagtggtactttagtgaaaaatccctataggcagtct
actccagaatcaacagaaattcatttagttctcagtaaaatggttgctaataatgttgaa
tatgctattattgaatcaacttctcatggtcttgatgataggacatcaaggcttcttgat
attgaatattctgttgctgttttgactaatatcagtcatgaacatcttgaatttcatggt
accatgcagaattatttgagagccaagcttaatcttttttattctgcaaattctcatggt
ggttttggtattatcaatatggatgataatcatttttctgtgtttatgaattctattaat
aggacttatacctatagtttgaaaaatgaaaaagctgatttttttataagtaagattaat
gaacaaatgggttttactgaatttgagttttatcataataaaattaaatatgctgctaga
gttaatttgacgggtagttttaatgttgaaaatgttatggctgccttaattgttgttagt
caagttatgaatgttgatatttcaaaacttatttataagcttgttaatattgagagtctt
tatggacgcatgcaagatattaattttggccaagatttttctttaattgttgattatgca
cataccccaggtgcttttcttaaaatgtttcctatatttaaacgacttgcaaagaagcgt
ttaatttctgtttttggttctgctggggagagagatattcttaagagaaggttgcaggga
gaaattgcagatgagtattcagatgtaataatactttgtgatgaggatccaagaggtgag
gattctatgcaaataattagagatattgcggaaggaattgtaacaaaaaccttaaataaa
gatttgttttttattcctgatagaaaatgtgcaattgaaaaagcaataaatattgcatgt
ggtgacgatttggtggttactcttggaaagggacatgaaagttcaataatctataaagat
aaaagtattttttgggatgaacaagcggttattaaagatattattttaagtttgggaaat
aggggttag

DBGET integrated database retrieval system