KEGG   Borrelia crocidurae: Q7M_201Help
Entry
Q7M_201           CDS       T02051                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bcw  Borrelia crocidurae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Q7M_201
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q7M_201
Enzymes [BR:bcw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Q7M_201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(203158..204366)
Genome map
AA seq 402 aa AA seqDB search
MMSLQKKLKIIGVTGTDGKSSVCFYIYTLLKSMGAKVGFISTVFLEDGSGTLVKNPYRQS
TPESTEIHLVLSKMVANNVEYAIIESTSHGLDDRTSRLLDIEYSVAVLTNISHEHLEFHG
TMQNYLRAKLNLFYSANSHGGFGIINMDDNHFSVFMNSINRTYTYSLKNEKADFFISKIN
EQMGFTEFEFYHNKIKYAARVNLTGSFNVENVMAALIVVSQVMNVDISKLIYKLVNIESL
YGRMQDINFGQDFSLIVDYAHTPGAFLKMFPIFKRLAKKRLISVFGSAGERDILKRRLQG
EIADEYSDVIILCDEDPRGEDSMQIIRDIAEGIVTKTLNKDLFFIPDRKCAIEKAINIAC
GDDLVVTLGKGHESSIIYKDKSIFWDEQAVIKDIILSLGNRG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccttcaaaaaaaacttaaaattattggtgttacaggaactgatggtaagagt
tctgtttgtttttatatttatactttattaaaatctatgggtgctaaagttgggtttatc
tcaacagtgtttcttgaagatggaagtggtactttagtgaaaaatccctataggcagtct
actccagaatcaacagaaattcatttagttctcagtaaaatggttgctaataatgttgaa
tatgctattattgaatcaacttctcatggtcttgatgataggacatcaaggcttcttgat
attgaatattctgttgctgttttgactaatatcagtcatgaacatcttgaatttcatggt
accatgcagaattatttgagagccaagcttaatcttttttattctgcaaattctcatggt
ggttttggtattatcaatatggatgataatcatttttctgtgtttatgaattctattaat
aggacttatacctatagtttgaaaaatgaaaaagctgatttttttataagtaagattaat
gaacaaatgggttttactgaatttgagttttatcataataaaattaaatatgctgctaga
gttaatttgacgggtagttttaatgttgaaaatgttatggctgccttaattgttgttagt
caagttatgaatgttgatatttcaaaacttatttataagcttgttaatattgagagtctt
tatggacgcatgcaagatattaattttggccaagatttttctttaattgttgattatgca
cataccccaggtgcttttcttaaaatgtttcctatatttaaacgacttgcaaagaagcgt
ttaatttctgtttttggttctgctggggagagagatattcttaagagaaggttgcaggga
gaaattgcagatgagtattcagatgtaataatactttgtgatgaggatccaagaggtgag
gattctatgcaaataattagagatattgcggaaggaattgtaacaaaaaccttaaataaa
gatttgttttttattcctgatagaaaatgtgcaattgaaaaagcaataaatattgcatgt
ggtgacgatttggtggttactcttggaaagggacatgaaagttcaataatctataaagat
aaaagtattttttgggatgaacaagcggttattaaagatattattttaagtttgggaaat
aggggttag

DBGET integrated database retrieval system