KEGG   Borrelia crocidurae: Q7M_208Help
Entry
Q7M_208           CDS       T02051                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcw  Borrelia crocidurae
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7M_208
   00052 Galactose metabolism
    Q7M_208
   00500 Starch and sucrose metabolism
    Q7M_208
   00520 Amino sugar and nucleotide sugar metabolism
    Q7M_208
Enzymes [BR:bcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Q7M_208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211136..211966
Genome map
AA seq 276 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFINSGIKEILIITSRRKKVL
DNYFDREVELEHTFIKECQKDFLEQIKLKDINICFIRQNTMMGTGHALLHAKPWIGNESV
IVAYPDDLHIGSPPLTAQLIELYKKTGKNILSVIENPKNINRYGVIELNQDNIHVKNIVE
KPAIGHEPSNKASIGRFLYTNEFFKFLEEGFKFHQKGEYHHIYALKKLMIENKVLYKKIE
GERLDIGDIEGYLETIIKIAKQDDKLLQIINNSLRN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattatattagcagcaggatatggcacaagatttttacccataacaaaaact
attccaaaagaaatgttaccaattttaaataaaccatcaattgattatattattgaagaa
tttattaattctggaattaaagaaatactcataataacttcaagaagaaaaaaagttttg
gataattactttgacagagaagttgaacttgaacatacattcatcaaagaatgccaaaaa
gattttttagaacaaattaaacttaaagacattaacatttgttttataagacaaaataca
atgatgggcacagggcatgcattacttcatgcaaagccttggataggcaatgaaagcgta
atagttgcataccccgatgatctacatattggatcaccacccttaacagcacaattaata
gaactatataaaaaaactggtaaaaatatattatccgttatcgaaaatcccaaaaatatc
aatagatacggagtaatagaattaaatcaagataatattcatgtaaaaaacatagtagaa
aaaccagcaattggtcacgaaccaagcaataaagcatctataggaagattcttatatacc
aatgaattttttaaatttttagaagaaggttttaaatttcaccaaaaaggagaatatcac
catatttatgcattaaagaaactaatgattgaaaacaaagtattatacaaaaaaattgaa
ggagaaagacttgatataggtgatattgaaggttatttagaaacaataatcaaaattgca
aaacaagatgataaattactccaaatcatcaacaattcattaaggaattaa

DBGET integrated database retrieval system