KEGG   Borrelia crocidurae: Q7M_29Help
Entry
Q7M_29            CDS       T02051                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcw  Borrelia crocidurae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7M_29
Enzymes [BR:bcw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Q7M_29
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24418..25008)
Genome map
AA seq 196 aa AA seqDB search
MINKIYGKIVDKKESSIIILAFPFEFEILVSSFCKMELRLLEDVEILTYFHFRDDDVKLF
GFLNISEREVFEDLIGVDGIGPKAALKILSGIKYDAFRLAIEKEDINLISKVKGIGNKIA
GKIFLKLRGKLVKGDESSSYVLKFKELEQSIVNMGFDRKLVVVAFREIMLSDKFLILKEA
DQEQFLFTETLKRLSV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttatggtaagattgtagataaaaaagaatctagtattatcatttta
gcttttccgtttgaatttgagattttagttagttctttttgtaaaatggaattgaggttg
ttagaagatgttgaaatattaacctattttcattttagagatgatgatgttaagcttttt
ggatttttaaatatatcagaacgggaagtttttgaagatttaattggtgttgatggaata
gggccaaaagcggctttgaaaatattatctggaattaaatatgatgcatttcggcttgct
attgaaaaagaagatattaatcttatttctaaggttaaaggtattggaaataaaatagcg
gggaaaatatttttaaaacttagaggtaaacttgtaaagggtgatgaatcaagttcgtat
gtgttgaaatttaaagagcttgaacaatcaattgtgaatatgggttttgatagaaaattg
gttgtagttgcgtttagagaaattatgcttagtgataaatttttaattttaaaagaagcc
gatcaagaacaatttttatttacagagactttaaaaagactttcagtttag

DBGET integrated database retrieval system