KEGG   Borrelia crocidurae: Q7M_421Help
Entry
Q7M_421           CDS       T02051                                 

Definition
(GenBank) hypothetical protein
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bcw  Borrelia crocidurae
Pathway
bcw02020  Two-component system
bcw02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Q7M_421
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Q7M_421
Enzymes [BR:bcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Q7M_421
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Q7M_421
Two-component system [BR:bcw02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Q7M_421
Bacterial motility proteins [BR:bcw02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Q7M_421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest DUF5096
Motif
Other DBs
NCBI-ProteinID: AFI31200
UniProt: I0FCJ4
Position
431015..431515
Genome map
AA seq 166 aa AA seqDB search
MVVIGISTGGPAALKIILSEISKNFPIPIVIVQHMPKGFTTEFANNLNKICNLTVKETKN
NEILQKGCIYISSGGYHTKINKINDNYQIEVFDAENVNGHKPSIGVLFKSISENVKEKVI
ALIMTGMGNDGSREIGDIKKAGGVTIAQDEKSSVVFGMPKNCNRRK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggtagttattggaatatccacaggaggccctgcagcattaaaaataattttatcagaa
atttccaaaaactttcctattccaatagtaattgttcaacatatgccaaaaggatttact
acagaatttgcaaacaatcttaataagatttgtaacttaactgtaaaagaaacaaaaaac
aatgaaatacttcaaaaaggatgcatatatataagttctggaggatatcacacaaaaata
aacaaaataaacgataattatcaaatagaggtttttgatgcggaaaatgtcaacggacac
aaaccttctataggagtactattcaagtcaatatcagaaaacgtaaaagaaaaagtcata
gctctcataatgactggaatgggaaatgacggttccagagaaattggagatattaaaaaa
gctgggggcgtaactattgcacaagatgaaaaaagctcagtggtatttggaatgccaaaa
aattgcaatagaagaaaataa

DBGET integrated database retrieval system