KEGG   Borrelia crocidurae: Q7M_469Help
Entry
Q7M_469           CDS       T02051                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
bcw  Borrelia crocidurae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488972..489556
Genome map
AA seq 194 aa AA seqDB search
MIIQDLIELVSKLPGIGKKTAARMVYDILYTGENFSRALGQILIRLHLEIQKCKNCYNFA
EEELCNICTNLNRNKGIICVVEMPQDLEVIEATKEYDGFYFVLHGHLDPLRNIGPDELNL
DKLKNYIKLLKAEEVIIATEFSIEGDVTANYISNLLKDLDINVTRIASGLPAGGSISNAD
KVTTLRALRLRLKM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgattatacaagatttaattgaattagtttctaaacttccaggcataggaaaaaaaaca
gcagcacgaatggtttatgatattttgtataccggtgaaaatttttcaagagcattggga
caaattttaattagacttcatttagagatacaaaaatgtaaaaattgttacaattttgct
gaagaagaactttgtaatatttgtacgaatttaaatagaaataaaggtataatttgcgtt
gtagaaatgcctcaagatctggaagttattgaggctactaaggaatatgatggattttat
tttgttcttcatggtcatcttgatcctttaagaaatattggaccagatgagttaaatctt
gataaattaaagaattatattaaactattaaaagcagaagaagtaattattgctactgaa
tttagtattgagggagatgtaactgcaaattatatcagtaatcttttaaaggacttagat
attaatgttacaagaatagcatctggtcttcctgctgggggtagtattagtaatgcagat
aaagtgactactcttagggcattacgtttgagacttaaaatgtga

DBGET integrated database retrieval system