KEGG   Borrelia crocidurae: Q7M_469Help
Entry
Q7M_469           CDS       T02051                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
bcw  Borrelia crocidurae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7M_469
DNA repair and recombination proteins [BR:bcw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Q7M_469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488972..489556
Genome map
AA seq 194 aa AA seqDB search
MIIQDLIELVSKLPGIGKKTAARMVYDILYTGENFSRALGQILIRLHLEIQKCKNCYNFA
EEELCNICTNLNRNKGIICVVEMPQDLEVIEATKEYDGFYFVLHGHLDPLRNIGPDELNL
DKLKNYIKLLKAEEVIIATEFSIEGDVTANYISNLLKDLDINVTRIASGLPAGGSISNAD
KVTTLRALRLRLKM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgattatacaagatttaattgaattagtttctaaacttccaggcataggaaaaaaaaca
gcagcacgaatggtttatgatattttgtataccggtgaaaatttttcaagagcattggga
caaattttaattagacttcatttagagatacaaaaatgtaaaaattgttacaattttgct
gaagaagaactttgtaatatttgtacgaatttaaatagaaataaaggtataatttgcgtt
gtagaaatgcctcaagatctggaagttattgaggctactaaggaatatgatggattttat
tttgttcttcatggtcatcttgatcctttaagaaatattggaccagatgagttaaatctt
gataaattaaagaattatattaaactattaaaagcagaagaagtaattattgctactgaa
tttagtattgagggagatgtaactgcaaattatatcagtaatcttttaaaggacttagat
attaatgttacaagaatagcatctggtcttcctgctgggggtagtattagtaatgcagat
aaagtgactactcttagggcattacgtttgagacttaaaatgtga

DBGET integrated database retrieval system