KEGG   Borrelia crocidurae: Q7M_480Help
Entry
Q7M_480           CDS       T02051                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcw  Borrelia crocidurae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcw00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bcw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496498..497778
Genome map
AA seq 426 aa AA seqDB search
MYSYLVEGGFKIGGKITASGNKNAALPCMIAALLTDEEVILENVPNIRDVEVILKILEDI
GVDVIRDGNILKIKALNIAKTEIDSSLTDLIRASILFVGPMLARCGQIDIAPPGGDVIGK
RRLDTHFYGLGKLGAKLVENERIVLEVDNLIGAEMFLDEASVTATENIIMASVLAFGETV
IMNAACEPHVQDLCNMLNLMGADISGIGSNLLKIRGVKKLRGAKFRIGSDFMQIGSLISL
AALTGGELEINKADPGNFILIRHVYSKLGIDFEYDNENIYVKEKQYLKVRLDFGGHIPKI
DDGPWPSFPTDLMSIMIVTATQVQGTVLIFEKMFESRMFFVDKLIKMGAQIVLCDPHRVV
VTGKTILKGSDVSSPDVRAGMSLLIAALCAEGKSRIHNIYQIERGYEDVVSKLSFLGARI
KRVRDE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtatagctatcttgtggaaggtggttttaaaataggtggaaaaataacggcgagtgga
aataaaaatgcggctttaccttgcatgatagcagcattgcttacagatgaagaagtgatt
ttggaaaatgttccaaatattagagatgtagaggttattttaaaaattttagaagacata
ggcgttgatgttataagggatggtaatatccttaaaattaaggccttaaatattgcgaaa
acagaaatagattcttctttaacggatttaattcgagcttcaattttatttgtaggacct
atgcttgctaggtgtgggcaaattgatattgctcctccgggtggagatgttattggtaaa
aggcgtcttgatactcatttttatggtcttggtaagcttggtgctaagttggtagagaat
gaacgtattgttttagaggtagataatttaattggtgctgagatgtttttggatgaggca
tcagttacggctactgaaaatattattatggcttctgttcttgcttttggagaaactgtg
ataatgaatgctgcatgtgaaccacatgtgcaagatttgtgtaatatgttgaatttgatg
ggagctgacatttctggaattggttctaatttgcttaaaataagaggtgttaagaaatta
agaggggctaaatttaggataggttctgattttatgcagataggttcattaattagtctt
gctgcattaacgggaggtgagcttgagattaataaggctgatcctggtaattttatttta
ataaggcatgtatattcaaaacttggtattgattttgaatatgataatgaaaatatatat
gttaaagaaaaacagtatttaaaagtaaggttggattttggaggacatattcctaaaatt
gatgatggtccttggccatcttttccaacagatcttatgagtattatgatagtaactgcg
actcaagttcaagggactgtgcttatttttgaaaaaatgtttgaatcaaggatgtttttt
gtagataaacttattaaaatgggagctcaaattgttctttgtgatcctcatcgtgtggta
gttacagggaaaactattcttaagggaagtgatgtatcttctcctgatgttagagcaggt
atgtctttgcttattgcagctctttgtgctgagggtaagagtcgtattcataatatttat
caaattgagaggggatatgaagatgttgtttctaagttgagctttcttggtgcaagaatt
aaaagagtgagagatgaataa

DBGET integrated database retrieval system