KEGG   Borrelia crocidurae: Q7M_576Help
Entry
Q7M_576           CDS       T02051                                 

Definition
Protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bcw  Borrelia crocidurae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bcw02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bcw02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588337..589488
Genome map
AA seq 383 aa AA seqDB search
MKILVIDIQGLIRQVFVRAFSKDVDVEILNPGSNSLNLINVFLQKFPDVVIIDENTAKSH
FGNSLNNVLNNISLPVVFIAENEVYPKFGFLDSKKDKIKLIINKLNFKLTVNLFRSDYLD
LIKSEIKKLVDHKFVASFESKRIKSPDFFEKTESKESERDITNITKSYKVADVINVSPKN
GPDVILKYQGVINKNKTGKVVFVGASTGGTEALRVFLKLFKKDSPPIVIVQHMPGGFTTS
FAKSLNNEFEVDIKEAEDGDILRPGLVIIANGHYHLIVKYANGNYFTHLIDGPPVSRHKP
SVNVLFRSAAMYAGENAIGVMLTGMGDDGASCMLEMKNNGAYNIAQDQLTSVVFGMPMEA
IKIGAVDKVLPLNKISECILRRS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattggtaattgatattcaaggtctgataagacaggtttttgttagagccttt
tctaaggatgtagatgttgagatattaaatccgggttctaattctttaaatcttattaat
gtttttttgcaaaaatttcctgatgtagttattattgatgaaaatacggctaagtcacat
tttggaaattcacttaataatgttcttaataatatttcacttcctgttgtttttatagca
gagaatgaagtttatccaaaatttggttttcttgattctaaaaaagataagattaaatta
ataatcaataaacttaattttaaacttacagttaatttatttagaagtgattatttagat
ttaattaaatcagagattaagaaattagtggatcataagtttgtagcttcttttgaaagt
aagagaataaaatctcctgatttttttgaaaagactgaaagtaaagagtctgaaagagat
attactaacataaccaaaagttataaagttgcagatgttattaatgtttctcctaaaaat
ggtccagatgttattctgaagtatcaaggtgtaattaataaaaataagacaggaaaagtt
gtttttgttggtgcttcaactggtggtactgaagctttaagagtttttttaaaattattc
aaaaaagattctcctccaattgtaattgttcaacatatgcctgggggttttacaacatct
tttgcaaaaagtttaaataatgaatttgaagttgatataaaagaagctgaagatggagat
attttaagacctggtcttgtaataattgcaaatggtcattatcatttaattgtgaaatat
gctaatggaaattattttactcatctaattgatggtcctccagttagcagacataaacct
tctgttaatgtattatttcgttctgctgctatgtatgcaggagagaatgccattggagtt
atgcttacgggaatgggggatgatggtgctagttgtatgcttgaaatgaaaaataatggt
gcatataacattgcacaagatcaattgacttctgtagtatttggtatgcctatggaggca
atcaagataggtgctgtggataaggtccttcctttaaataaaatatctgagtgtatttta
aggagatcttaa

DBGET integrated database retrieval system