KEGG   Borrelia crocidurae: Q7M_58Help
Entry
Q7M_58            CDS       T02051                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcw  Borrelia crocidurae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7M_58
   01230 Biosynthesis of amino acids
    Q7M_58
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7M_58
   00051 Fructose and mannose metabolism
    Q7M_58
   00562 Inositol phosphate metabolism
    Q7M_58
Enzymes [BR:bcw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Q7M_58
Exosome [BR:bcw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Q7M_58
  Exosomal proteins of bladder cancer cells
   Q7M_58
  Exosomal proteins of melanoma cells
   Q7M_58
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51648..52412)
Genome map
AA seq 254 aa AA seqDB search
MRKVFLAGNWKMHYTSVEAADVAKQIVDGVYNINNNVVVMVTPTFTSLCKVCRVTKGTNV
LLGAQNMSYENSGARTSEIAPSMLLEFGVDYVILGHSECRTYLGENDEIINKKVLTGLKH
PFKYLILCVGETLEEREKGKTLDVVLNQVRNGLASVYESDLQRIILAYEPVWAIGTGKTA
TKEEAQEVHKAIRLEIQSLYSKSAADNIIIQYGGSVNVDNVEGLMGENDIDGALIGGASL
KADSFLKIINKISK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggttttcttagcaggaaattggaaaatgcattatacaagtgtagaggccgca
gatgttgctaagcagattgtagatggtgtatacaatattaataataatgtggttgttatg
gtaacacctacatttacgtccctttgtaaagtttgtagagtaactaaaggaaccaatgtt
cttcttggtgctcaaaatatgtcttatgagaatagtggagctagaacaagtgaaattgcg
ccttctatgcttttggaatttggggttgattacgtaatacttggacattctgaatgtaga
acatatcttggcgaaaatgatgaaattataaataagaaagttcttacaggtcttaaacat
ccatttaaatatttgattctctgtgttggagaaacccttgaggagagagaaaaaggtaaa
actttagatgtagttttgaatcaggttagaaatggattagcatctgtatatgaatctgat
cttcagagaataattttagcttatgaacctgtatgggcaattgggacaggaaagacagca
acaaaagaagaagcacaagaagttcataaggcaattagacttgagattcaatctttatat
tcaaagtccgcagcagataatattattattcaatatggtggttctgttaatgttgacaat
gtggaaggtttaatgggtgaaaacgatattgatggagcattaattggtggtgcatcttta
aaagcagattcgtttttaaagataattaataaaatatcgaagtag

DBGET integrated database retrieval system