KEGG   Borrelia crocidurae: Q7M_628Help
Entry
Q7M_628           CDS       T02051                                 

Definition
Beta-glucosidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bcw  Borrelia crocidurae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcw00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bcw00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650957..652612)
Genome map
AA seq 551 aa AA seqDB search
MKKIIYIIVFLINNNCFCYDFWSTENKEKLIEQIVSQMNDKELLGQMFMISYPKEKITNF
TLNFIKEKNLGGIKIFGWNAKNLYKLIESINKAQTISQKNRFKIPLFIATDQEGGWTQHI
KLKTSKTIGNLGITATLSPNDAYFTGYHIANELKQLGININFAPITDIYSNEENFIIGPR
TYSNNPQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTVIDSHIKMPIINSDLKEIKTNE
LLPYKILIQENIPMIMSGHLAYPMLTNGKEIPASSSTKIIKEILRQDLKYDNLIITDDLL
MNAVRYQNESIYDTIERIIRTETDILLISLNEDIQNNAYNQLLNLMQKDNTIKENIIKSN
KRILRIKLEYLKEKRNKEELFPKYDNAKEIPTKEAEFFFEQNTLRSITKIKLSKKISKHK
KTLLISPYNTMIKEGKKIFQNSYGYYYNYYPLNSINPTQLKEIKNLIAKYEQVIFNVSTP
ASLEYIKNLKEYKNKISIIVSLTPQHIKQLNWIENIVVVYGTTTLSFKSGFLTLTEDFNP
KGQIPLMNLKN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattatttatataattgtttttttaattaataataattgtttttgttatgac
ttttggagtacagaaaataaagaaaaactaatagaacaaatagtaagtcaaatgaatgac
aaagaattattgggacaaatgtttatgataagttatccaaaagaaaaaataacaaacttc
accctaaacttcatcaaagaaaaaaatttaggtggaatcaaaatttttggatggaatgca
aaaaatttatacaaattaatagaaagtataaataaagcacaaacaatttctcaaaagaat
agatttaaaattcccttatttatagcaacagatcaagaaggtggatggacacaacatata
aaacttaaaacatcaaaaacaataggaaatcttggaatcacagcaactctatcaccaaat
gatgcctactttactggatatcatatagcaaatgaattaaaacaacttggaattaacata
aattttgccccaataacagatatttacagcaatgaagaaaatttcataataggtccaaga
acatattcaaataatccacaaatcgtatccctatttgcattggctttctataaaggacaa
aaacaagcaggcattatctcaacagcaaaacattttcccggacatggcaatactgttatt
gattctcatataaaaatgccaataatcaattcagatttaaaagaaattaaaacaaatgag
ttgctgccatataaaatattaatacaagaaaacattccaatgattatgagtggacactta
gcatatccaatgcttacaaacggaaaagaaatacctgcatcctcatcaactaaaattatc
aaggaaattcttaggcaagacttaaaatacgacaatttaataataacagacgacctgcta
atgaatgcagtaagatatcaaaatgaaagcatttatgacacaattgaacgaattattaga
acagaaactgatattttattaatatcattaaatgaagatatacaaaataatgcttacaat
caactattaaacctcatgcaaaaagacaatacaataaaagaaaacattattaaatctaac
aaaagaatacttagaataaaattagaatatctaaaagaaaaaagaaacaaagaagaactt
ttccccaaatatgacaatgccaaagaaatacctactaaagaagctgaatttttttttgaa
caaaatacattaaggagcataacaaaaataaaactatcaaaaaagatatcaaagcacaaa
aaaacgctattaatatcaccttataatacaatgattaaagaaggtaaaaaaatatttcaa
aatagttatggctattattataattattatccactaaatagcataaatcccacacaatta
aaagaaataaaaaatttaattgcaaaatatgaacaagttatttttaatgtatcaacacct
gctagtttagagtacataaaaaatttaaaagaatataaaaataaaataagcatcattgta
tctcttaccccccaacacattaaacaacttaactggatagaaaacatagtagtagtatat
ggaactacaacactatcatttaaatctggatttttaactttaacagaagattttaatcca
aaaggacaaatacctttaatgaatctcaagaattaa

DBGET integrated database retrieval system