KEGG   Borrelia crocidurae: Q7M_639Help
Entry
Q7M_639           CDS       T02051                                 

Definition
Exodeoxyribonuclease V, alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcw  Borrelia crocidurae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7M_639
Enzymes [BR:bcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Q7M_639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(667227..669053)
Genome map
AA seq 608 aa AA seqDB search
MRNYLVLREFLQEEQKNYLNPELKIYEIIEILNINVEQYYKSHLLTKKIQNDKYEELTIF
LIFIFNYFSKGHLRANIDLLIQDIQNTIDCALLELEEENQHYQKSTHILQELTKFSKETQ
IKEMILYLEKNNIMKNYNQNEKITTPLILENNIYIYTQKNFREEEELIKQIDKRLKNNKT
EISDDRIQNIMDHLNITNLSKEQINSIKKALKSNFFILSGGPGTGKTTTINYILKAIDIH
LDCKQNVALVAPTGKASQKLKSSIKEPFKNLETQYSTIQKLLKISFINKDDKYDENNPLE
FEIIIIDEASMIDANTFLRLLKALKANTKIIITGDKNQLPSIAGGNVYSSLTKIKEINDD
SVEILKKNFRSNDEINLLAKAIYKEDMDLIETQFNDSKNIILKNLNKINIENELLKHTKK
LYNNIPNFNLNSLNDKEIESIIHTLLSNTILCSKNLGKFGTQKINEIIKLYLKKLYGNLI
GQIILITQNDYKNDLFNGERGILFKENSKIYALFKRENEKYKKINFNLINKYELSFATTI
HKSQGSEYQHIQIIIENHPFLTKELLYTAITRARESIEIISNKEIIKNVSLKKINRDSKI
TEYINTLK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattatttagtcttaagagaattcctacaagaagagcaaaaaaactacttaaat
ccagaactcaaaatttatgaaataattgaaattttaaatataaatgtagaacaatattac
aaatcacatttacttacaaaaaaaatacaaaatgacaaatatgaagaacttaccattttt
ttaatattcatatttaattacttctctaaaggacacttaagagcaaatattgatctacta
atacaagatattcaaaacacaatcgactgtgctttactcgaattagaagaagaaaatcaa
cactatcaaaaatcaacacacatattacaagaacttacaaaattttcaaaagaaactcaa
ataaaagaaatgatattatatttagaaaaaaataatataatgaaaaattacaatcaaaat
gaaaaaataacaactcctttaatattagaaaataatatttacatttacacccaaaaaaat
tttagagaagaagaagaattaataaaacaaatagacaaaagacttaagaacaataaaaca
gaaataagtgatgatagaatacagaacatcatggatcacttaaatattacaaatttaagt
aaagaacaaataaactcaattaaaaaagctttaaaaagtaatttttttatattaagtggt
ggaccaggaacaggcaaaacaacaacaattaactatattctcaaagcaattgacatacat
ttagattgtaaacaaaacgtagctcttgtagcaccaaccggaaaagcaagtcaaaaattg
aaatcaagtattaaagaaccatttaaaaaccttgaaacacaatatagcacaatacaaaaa
ctattaaaaatatcattcataaataaagacgacaaatatgatgaaaataatcctttagaa
ttcgaaataattataatagatgaagcatctatgatagatgcaaatacctttttaagatta
ttaaaagcattaaaggcaaatacaaaaattataataacaggggataaaaaccaacttcca
tcaatagctggaggaaatgtatattccagccttacaaaaataaaagaaataaatgatgat
agtgtagaaatactgaaaaaaaattttagaagcaatgatgaaataaatttattagccaaa
gcaatatataaagaagatatggacttaattgaaactcaatttaatgatagcaaaaacata
attctaaaaaacctaaataaaataaatattgaaaatgaattactaaaacatacaaaaaaa
ttatacaataacattcccaatttcaatcttaactcgttaaatgacaaagaaattgaatca
ataattcatacactgcttagtaacacaattttatgttcaaaaaatcttggaaaatttggc
acacaaaaaataaatgaaataattaaattatatttaaaaaaattatatggaaatttaatt
ggacaaataattttaattactcaaaatgattataaaaatgacctatttaatggggagaga
ggaatactttttaaagaaaattctaaaatttatgctctatttaaaagagaaaatgaaaaa
tacaaaaaaataaacttcaacttaataaataaatatgaactgagctttgcaacaacaata
cataaaagccagggctctgaataccaacacatacaaattataatagaaaatcaccctttc
ttaacaaaagaattactctacactgcaataacaagagctagagaaagtatagaaataata
tcaaacaaagagataattaaaaatgtcagtttaaagaaaatcaatagagactccaaaatt
acagaatacataaacacgttaaaataa

DBGET integrated database retrieval system