KEGG   Borrelia crocidurae: Q7M_667Help
Entry
Q7M_667           CDS       T02051                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcw  Borrelia crocidurae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7M_667
   01230 Biosynthesis of amino acids
    Q7M_667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7M_667
  Energy metabolism
   00680 Methane metabolism
    Q7M_667
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7M_667
Enzymes [BR:bcw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Q7M_667
Exosome [BR:bcw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Q7M_667
  Exosomal proteins of melanoma cells
   Q7M_667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700941..701693
Genome map
AA seq 250 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGVSEACEGGRILKKEGYSFDIAFSSMLLR
ANDTLNIILCELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVP
PMPLDESDKRHPIHDSRYKNIPKSELPSTECLKDTVARVIPYWTDKIAKAILEGKRVIVA
AHGNSLRALVKYLDNMSEEDILKLNIPTGIPLVYELDKDLKPVKHYYLGDEDKIKAAMES
VANQGKKIDR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggtgagagtgaatggaataaggaaaatcttttt
acaggatggactgatgttaaactttctgagaagggtgtttctgaagcttgtgagggtggt
agaatattgaaaaaggaaggttattcttttgatattgcttttagctcaatgttattaaga
gctaatgatactttaaatattattttgtgtgaattgggtcaatcgtatattgatgtagaa
aaatcttggcgacttaatgagagacattatggggcattgcaaggattaaataaggctgaa
acggctgaaaagtatggcgaagataaagttctcatttggagacgtagttataatgttcct
cctatgcctttggatgagtctgataagcgtcatcctattcatgattcaagatataaaaat
attcctaaaagtgaacttccttcaaccgagtgtttaaaagatactgttgcaagagttata
ccatattggacagataaaattgctaaggctattcttgaaggaaaaagagttattgttgct
gctcatggtaattctttaagagcccttgttaaatatcttgataatatgagtgaagaagat
attttaaagctaaatattccaacgggtattcctttagtttatgagcttgataaggattta
aaacccgttaaacattactatttgggcgatgaagataaaattaaggcagctatggaatct
gttgctaatcaaggtaaaaaaatagatagataa

DBGET integrated database retrieval system