KEGG   Borrelia crocidurae: Q7M_738Help
Entry
Q7M_738           CDS       T02051                                 

Definition
Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (Pfk)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcw  Borrelia crocidurae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7M_738
   01230 Biosynthesis of amino acids
    Q7M_738
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7M_738
   00030 Pentose phosphate pathway
    Q7M_738
   00051 Fructose and mannose metabolism
    Q7M_738
   00052 Galactose metabolism
    Q7M_738
  Energy metabolism
   00680 Methane metabolism
    Q7M_738
Enzymes [BR:bcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Q7M_738
Protein phosphatases and associated proteins [BR:bcw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Q7M_738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769243..770586
Genome map
AA seq 447 aa AA seqDB search
MYRLKNQNLGFNIENLGECKYDNPLINFYANESHVHFTSEESKIRFNVYKNEESWNQYED
VFLEKAGPRRKIYFVPKHVKAAITTCGGLCPGFNDVIRSIVRTLWNVYGVYNIYGVKFGY
KGLLSESNLSFVDLNPDMVNDINQLGGTILGSSRGGIRPVEIVDTLERMGINMLFNIGGD
GTQKGSILIAEEIERRNLKIAVIGIPKTVDNDFMFVQKSFGFETAVEQSVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAYTALSSNDVNFCLIPELDFDIEGPNGLLAHLERRLLQK
ESMDEIPHAVILIAEGAGQKYFDPGIRKKDDSGNLLYEDIGLYIKDKINEYFKSKDIPVN
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKLLISLWSTKFVHVPIKMAVI
ARNKVNVNGSFWRDVLASTGQPFSMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtataggcttaagaatcaaaatttgggttttaatatagaaaacctaggagaatgtaaa
tatgataatcctttaattaatttttatgctaatgagagtcatgttcattttacttctgaa
gagagtaagattagatttaacgtttataaaaatgaagagagttggaatcaatatgaggat
gtttttttagaaaaggctggacctagacgtaaaatttattttgtcccaaaacatgttaaa
gctgcaattactacttgtggaggtctctgtccaggttttaatgatgtgattcgttcaatt
gttagaactttatggaatgtatatggagtatataatatttatggagttaagtttggatat
aaaggacttttgtcagagtctaatttgagttttgttgatttaaatcctgatatggttaat
gatattaatcagcttggtggtacaatacttggttcatcaagaggaggaattagacctgtt
gaaatagttgatactttagagagaatgggtattaatatgctttttaatattggtggagat
ggtacacaaaagggttctattttaattgctgaagagatagagagacgaaatttaaaaatt
gctgttataggtattcctaaaacagtagataatgattttatgtttgttcaaaaatctttt
ggatttgagactgctgtagaacaatcagttgctgctgttgctggtgcgcattttgaggca
aatagtgcttataatggaataggtcttgttaaggtgatgggtagagattctgggtttatt
gctgcttatactgctctatcttctaatgatgttaatttttgtttaataccagaattagat
tttgatattgagggtcctaatggacttcttgcacatcttgagagacgacttttacaaaaa
gaaagtatggatgaaattcctcatgcagttatattgatagcagaaggagcaggacaaaaa
tattttgatcctggtattaggaagaaagatgattctggtaatttactgtatgaggatatt
ggactttatattaaagataaaattaatgagtattttaaatctaaagatattcctgttaat
cttaaatatattgatcctagttatattattagaagttctccagctaatgctagtgattct
ctctattgtgctcgtcttggttcaaatgctgttcatgctgctatggctggtaaaacgaaa
ttattaattagcttgtggagtacaaaatttgtgcatgttcccatcaaaatggctgtcatt
gctaggaataaagttaatgtgaatggttctttctggagggatgttcttgcaagcactggt
cagccatttagtatgaaaaattaa

DBGET integrated database retrieval system