KEGG   Bacillus cereus 03BB102: BCA_0054Help
Entry
BCA_0054          CDS       T00869                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00900  Terpenoid backbone biosynthesis
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01130  Biosynthesis of antibiotics
Module
bcx_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCA_0054 (ispE)
Enzymes [BR:bcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BCA_0054 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACO25962
UniProt: C1ESX4
Position
47993..48862
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaacaatcgatttagcggatcgt
ttagaactaatggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaaagaaatctggcttatcaagcagcgaaattattaaaagagaagtttaat
gtgaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagcg
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggc
cttacgattgatcaattagcagagcttggcgcagaaattggatcagatgtatcgttttgt
gtatatggtgggacagcaattgccactggaagaggagagcagattgagcacataaaaact
ccaccttcttgttgggttattttagcaaagcctcatattggtgtatctactgctgatgta
tatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatggtggatgtc
ataaacgctggagactacaaagggatttgcgatactgttggtaacgttttagaagatgta
acgtttgctatgcatcctgaagttgcacgtattaaagcacaaatgaagcgatttggagca
gatgctgtattaatgagtggaagtggtccaactgtattcggcctagtgcaccatgattcg
cgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatacgcagtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system