KEGG   Bacillus cereus 03BB102: BCA_0086Help
Entry
BCA_0086          CDS       T00869                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78594..79109
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFEN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcttacattgcattaggttcaaatattggagaacgttatacgtattta
acggaagcgattcagtttctaaataaaaatccttatatcaaagttgaagatgtttcatct
gtatatgaaacggaaccagttggctatactgaccaaagttgctttttaaatttagttata
aaaatttctaccaatttatcaccgcaagaattattgaaagtaacgcaaaaagtagaaaat
gacctaggaagaaaaagggaaattaggtggggccctaggactatcgaccttgacatttta
ctatataatcaagaaaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagagattaatcaagatataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaaactaa

DBGET integrated database retrieval system