KEGG   Bacillus cereus 03BB102: BCA_1280Help
Entry
BCA_1280          CDS       T00869                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCA_1280 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCA_1280 (trpC)
Enzymes [BR:bcx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCA_1280 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199875..1200636
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVDQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEGCGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEKELEIAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIICVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtagatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagagaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcatcgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
cacgttgatgtacgaaaacaagtgaagacatatgaaggatgtggcgctggtgcagtttct
gttttaacagacggtcaattttttaaagggtcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttactaatcgtagcggcgttaacgaaagagaaa
ttaaaagagttgtatagctacgtactagaaaaaggattagaagcgattgttgaagttcat
gatgaaaaggaattagaaattgcaattcaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcgggattcattcaaaagaagacataatc
tgcgttaaacgagctggggcaaaaggtgtattagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system