KEGG   Bacillus cereus 03BB102: BCA_1283Help
Entry
BCA_1283          CDS       T00869                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCA_1283 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA_1283 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCA_1283 (trpA)
Enzymes [BR:bcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCA_1283 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1202441..1203217
Genome map
AA seq 258 aa AA seqDB search
MGVERIKAAFENGKKAFIPYVMGGDGGLEILKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKERFIENCMEAGV
DGIIVPDLPYEEQDIIAPLLREANIALIPLVTVTSPIERIKKIMSESEGFVYAVTVAGVT
GVRQNFKDEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICEFIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaagaattaaagcagcatttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaatattaaaagaaagaattcgttttttagacgaa
gcgggagcaagcatcgttgaaatcggtatcccgttttcagatccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggcattttt
caagcattaatagaggtaaggaaagaagtgcaaattccgtttgtactcatgacatattta
aatccagtacttgcattcgggaaagaacgatttatcgagaactgtatggaagcaggggta
gacggtattatcgttccggatttaccgtatgaagaacaagacattattgctccgttactt
cgagaggcaaacattgcgctcattccacttgttactgttacgagcccaattgagcggatc
aaaaaaattatgagtgaatcagaaggatttgtctacgccgttacagtagcgggcgtaaca
ggagtacgtcaaaattttaaagatgagattcatagttacttagaaaaagtaaaatcgcat
acacatttaccggtagtggcagggttcggtatttcaacaaaggaacatgtagaagaaatg
gttacaatatgtgatggagttgtcgttggaagtaaagtgattgagctattagaaaatgaa
aaacgagaagaaatatgtgaattcatacaggcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system