KEGG   Bacillus cereus 03BB102: BCA_2031Help
Entry
BCA_2031          CDS       T00869                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00260  Glycine, serine and threonine metabolism
bcx00750  Vitamin B6 metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01230  Biosynthesis of amino acids
Module
bcx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA_2031 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCA_2031 (thrC)
Enzymes [BR:bcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCA_2031 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACO26037
UniProt: A0A158RGE0
Position
1887515..1888573
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI
GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggattattaaaacagtatgcttcttatttaccggtgaatgaaaacacacca
gatgtgagcttaatggaaggaaatacacctcttattccgttgttaaatatatcaaaccaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcgtcaacaggtaatacatcagcatcggccgcagcatacgcggcacgtcttggaatgaaa
tgtattatcgtaatcccagaagggaaaattgcacatggaaaattagcgcaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaagctgtaaga
aatattgctgcggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagctgcaaagtgcaccagatgttcta
gcgattcctgttgggaatgcgggaaatattacagcgtattggaaaggtttctgtgaatat
gagaaagaaaaaggctataagaaaccaagaattcacggatttgaagcggaaggagcagct
gctattgtaaaagggcaggttattgaagaacctgaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctcagcaatctcacggcgaaata
gatatggtatcagatgaggagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtctcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system