KEGG   Bacillus cereus 03BB102: BCA_2031Help
Entry
BCA_2031          CDS       T00869                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCA_2031 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA_2031 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCA_2031 (thrC)
Enzymes [BR:bcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCA_2031 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1887515..1888573
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI
GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggattattaaaacagtatgcttcttatttaccggtgaatgaaaacacacca
gatgtgagcttaatggaaggaaatacacctcttattccgttgttaaatatatcaaaccaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcgtcaacaggtaatacatcagcatcggccgcagcatacgcggcacgtcttggaatgaaa
tgtattatcgtaatcccagaagggaaaattgcacatggaaaattagcgcaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaagctgtaaga
aatattgctgcggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagctgcaaagtgcaccagatgttcta
gcgattcctgttgggaatgcgggaaatattacagcgtattggaaaggtttctgtgaatat
gagaaagaaaaaggctataagaaaccaagaattcacggatttgaagcggaaggagcagct
gctattgtaaaagggcaggttattgaagaacctgaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctcagcaatctcacggcgaaata
gatatggtatcagatgaggagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtctcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system