KEGG   Bacillus cereus 03BB102: BCA_2154Help
Entry
BCA_2154          CDS       T00869                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCA_2154
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCA_2154
   00650 Butanoate metabolism
    BCA_2154
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BCA_2154
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCA_2154
   00622 Xylene degradation
    BCA_2154
   00621 Dioxin degradation
    BCA_2154
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCA_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000313..2001212
Genome map
AA seq 299 aa AA seqDB search
MQKVKAAIIGSGNIGTDLMYKLRKSEVIDLNAMIGIDVESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHRYHAKTLEELEKIVIDLTPAAYGPFVCPAIRNNNFLDKQN
VNMITCGGQATIPIVHAINGVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEV
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPGYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIISEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagtaaaggcggccataattggatcaggtaatattggtacggatttaatgtat
aaattaagaaaaagtgaagtcatagacctcaatgccatgattggaatagatgtagaatcg
gatggtttaaagagggcgaaagaagccggatacgaggtttttgataatggaatacaggca
attattgataatcccagtttagctgatattgtatttgatgcaacttcagctaaagcacat
agatatcatgcgaaaacgttagaagagcttgaaaaaatagtaattgacttaacaccggct
gcatatgggccatttgtttgtcctgctattcgaaataataattttttagataagcaaaac
gttaatatgattacgtgcgggggacaagcaacaatcccgattgttcatgctattaatggg
gtggcgaatgttacatatgcagagatcgttgctacaatttccagtttaagtgcaggtcca
ggtacaagggcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaagtt
ggcggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataagatggtagaacgggttaggacgtatgttcctggttactctttgaaacaagag
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcatctcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system