KEGG   Bacillus cereus 03BB102: BCA_2158Help
Entry
BCA_2158          CDS       T00869                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00260  Glycine, serine and threonine metabolism
bcx00680  Methane metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
bcx01230  Biosynthesis of amino acids
Module
bcx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcx_M00002  Glycolysis, core module involving three-carbon compounds
bcx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_2158
  Energy metabolism
   00680 Methane metabolism
    BCA_2158
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA_2158
Enzymes [BR:bcx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCA_2158
Membrane trafficking [BR:bcx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCA_2158
Exosome [BR:bcx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCA_2158
  Exosomal proteins of melanoma cells
   BCA_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF5317
Motif
Other DBs
NCBI-ProteinID: ACO30181
UniProt: A0A158RS93
Position
2003354..2003944
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTKKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYERIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTSHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatatcttaaacgtacatgaa
ggacgagctgattttgaattaacaaaaaaaggaagacaacaagtgcaaagacttgtacag
aaagtgaaagcagattttccgccagatttcatttgggcaagtacattaaaacgtgctcgt
gaaacgggtgaaacattagcggaaggaattgggtgtccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgaccgatttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggaatcttttctaaaatcgtgacagagaatacatatgaacgaattgctatt
gttgcacatggcggtgtaataaatagcctattacgtgcgtttttcaaaatgcccatttca
atggattattattttaaaatgggagatacgggaataagtttaattgaaattgatggtgaa
caaaaaacggtacatttcattaatgatacgagtcatttagacgggatgtaa

DBGET integrated database retrieval system