KEGG   Bacillus cereus 03BB102: BCA_2158Help
Entry
BCA_2158          CDS       T00869                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCA_2158
   01230 Biosynthesis of amino acids
    BCA_2158
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_2158
  Energy metabolism
   00680 Methane metabolism
    BCA_2158
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA_2158
Enzymes [BR:bcx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCA_2158
Exosome [BR:bcx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCA_2158
  Exosomal proteins of melanoma cells
   BCA_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2003354..2003944
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTKKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYERIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTSHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatatcttaaacgtacatgaa
ggacgagctgattttgaattaacaaaaaaaggaagacaacaagtgcaaagacttgtacag
aaagtgaaagcagattttccgccagatttcatttgggcaagtacattaaaacgtgctcgt
gaaacgggtgaaacattagcggaaggaattgggtgtccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgaccgatttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggaatcttttctaaaatcgtgacagagaatacatatgaacgaattgctatt
gttgcacatggcggtgtaataaatagcctattacgtgcgtttttcaaaatgcccatttca
atggattattattttaaaatgggagatacgggaataagtttaattgaaattgatggtgaa
caaaaaacggtacatttcattaatgatacgagtcatttagacgggatgtaa

DBGET integrated database retrieval system