KEGG   Bacillus cereus 03BB102: BCA_2350Help
Entry
BCA_2350          CDS       T00869                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCA_2350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_2350
  Lipid metabolism
   00071 Fatty acid degradation
    BCA_2350
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCA_2350
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCA_2350
   00626 Naphthalene degradation
    BCA_2350
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCA_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2183095..2184132
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVMKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIIQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDTVQNVFEEMEQGRIQGRMVIDFKQNNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagccaatattgaggttgttgaaaaggaa
ttacgtccgctacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcaaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtgtaggtattgtgatgaaaattgctgatgatgttacttcactaaaggtaggtgat
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtgactggt
agagaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgttacagctgattatgcagtgaaagtaccagaaggattagatcctgct
caagcatcatcgatcacatgtgcgggcgttactacatataaagctataaaagtatctgat
attaaacctggtcaaccgatcgtaatctatggttgtggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ctagccttagcaaaagaggttggtgctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattattcaagaggagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaggtagcattcaactcagcagttgacgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaactatggatttgaacattccgcgccttgtactagatggaatt
gaagtagttggttctttagtcggtactcgtaaggatctagaagaggcgtttatgttcggg
gcagaaggaaaagtagtgccagttgttcaaacttgttctttagatacagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaatcgattttaaacagaac
aattgtgattgcaaataa

DBGET integrated database retrieval system