KEGG   Bacillus cereus 03BB102: BCA_2486Help
Entry
BCA_2486          CDS       T00869                                 

Gene name
hemY2
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2317843..2319243
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLQEEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSVESLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLAVFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEMLTETV
VKKGAVTTAVSKQGDRYAISFANHDSIHADYVVLAAPHDIAETLLQSNELNEEFHTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRIFYKS
TNPVYETIKSYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQTL
QEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLNEPSN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgttgttatcggtggaggtattacaggactttctactatgttttattta
gagaaattaaaaaaggattataatattgatttgaatttaattcttgtagaaaaagaagag
tacttaggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcg
gattctattgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttacaa
gaagaaatggtatataatgagacgggtatttcttacatatattctgataatactttacat
ccaattccttctgacactatatttgggataccgatgagtgtcgaatcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaa
gagtttacaaaagatacatcacttgctgtatttttagaaagcttcttagggaaagaatta
gtagaaagacaaattgcgccagtgctttcaggcgtatattctggtaaattgaacgagctt
acaatggcatctacattaccatatttactggactataaaaataaatatggaagtattatt
aaaggctttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggtt
gttaagaaaggtgctgtaacgacagctgtaagtaaacaaggtgatcgctatgcaatctct
tttgcaaatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgaagagtttcatacatttaaaaactca
tctcttataagtatttacttaggatttgacatactagatgaacaattaccggcggacggc
acaggatttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaacaaaaactattagtgagaattttttataagagt
actaatccagtatatgaaacgattaaaagttatagtgaagaagaattagtacgggttgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaaacatta
caagaaaaaatgatgaatctttacccgaatatatacttggctggcgcttcctattatggt
gttggtattggtgcgtgtattggaaatggaaagaacattgcaaatgaaatcattgcaaca
ttaaatgaaccatcaaattaa

DBGET integrated database retrieval system