KEGG   Bacillus cereus 03BB102: BCA_2573Help
Entry
BCA_2573          CDS       T00869                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00260  Glycine, serine and threonine metabolism
bcx00680  Methane metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
bcx01230  Biosynthesis of amino acids
Module
bcx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcx_M00002  Glycolysis, core module involving three-carbon compounds
bcx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_2573 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCA_2573 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA_2573 (gpm)
Enzymes [BR:bcx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCA_2573 (gpm)
Membrane trafficking [BR:bcx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCA_2573 (gpm)
Exosome [BR:bcx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCA_2573 (gpm)
  Exosomal proteins of melanoma cells
   BCA_2573 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACO30111
UniProt: C1EUQ5
Position
2392029..2392766
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMNLSWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKELKKGEFPLTECLVDTEKRVLNYWHSEIAPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDDDLRPIRHYYLSMDGEVPEGEFP
KHIVF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgaaatgaatctttcctgggtaccagtacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggttaaataaagatgaa
acagcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcctagatatgaaatgaatgatccaagatataaagaa
ctgaaaaaaggtgagtttccattgactgaatgtttagtggatacggagaaaagagtactt
aattattggcattcagaaattgcgccatcattaaaaagtggtgaaaaggtgataatttca
tcgcacggtaatacaattcgttcgctagtgaaatacttagataacctttcaagtgatggt
gttgtttcattaaatattccaacaagcattccgctcgtttatgaattagacgatgattta
cgtccaattcgtcattattatttaagcatggacggagaagtaccagaaggggaatttccg
aaacacattgttttttaa

DBGET integrated database retrieval system