KEGG   Bacillus cereus 03BB102: BCA_2856Help
Entry
BCA_2856          CDS       T00869                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00020  Citrate cycle (TCA cycle)
bcx00620  Pyruvate metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
Module
bcx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_2856 (acoC)
   00020 Citrate cycle (TCA cycle)
    BCA_2856 (acoC)
   00620 Pyruvate metabolism
    BCA_2856 (acoC)
Enzymes [BR:bcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCA_2856 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACO26353
UniProt: A0A158RHC3
Position
complement(2654634..2655836)
Genome map
AA seq 400 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIKSLLGTGPGGRITKVDVLKALEERVAVPEVLEQEESKVIPVTG
MRKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVV
LALGDHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNVA
QKARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEYVPVYKGKKLK
KGSMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgctagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactgttcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaagattgcgaaaactgaaaatcttgatattaaatcatta
cttggtaccggtccaggtggaagaattacaaaggtagatgtattaaaggcgcttgaagaa
agagtagcagttccagaagtacttgaacaagaagaaagtaaagtaattcctgttactggt
atgcggaaagcaatcgcaaaccgtatgcatgcaagcttacaaaatagtgcacaattaaca
ttaacgatgaaagtagatgtgacagatttagttgctttacataaagaaatagcagaagtt
gtacaaaaacggtacgataacaaattaaccattacggatttcgtttctcgagctgttgta
ttagcgcttggggatcataaagaaatgaacagcgcttatatagatgatgcaattcatcaa
tttgaacatgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagct
attcgcttcgcaaataatctctcattagtagagttatctaaagagattaagaatgtggca
caaaaggcacgagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaatt
agtaatttaggaagcttcggtattgaatattttacaccagtattaaatacaccagaaact
ggtattttaggtgtaggtgcaattgaatatgttcctgtatataaaggaaaaaaattaaaa
aaaggaagtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcacca
gcagctgcatttttacgcacaattaaacgctatttagaagaacctgtaacaattctttta
taa

DBGET integrated database retrieval system