KEGG   Bacillus cereus 03BB102: BCA_3586Help
Entry
BCA_3586          CDS       T00869                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCA_3586
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_3586
  Lipid metabolism
   00071 Fatty acid degradation
    BCA_3586
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCA_3586
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCA_3586
   00626 Naphthalene degradation
    BCA_3586
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCA_3586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3341367..3342365
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFSGVIVKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGS
DLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGMPNA
RFGKEFGSGFFKTFLFSLASRKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKP
VIDRVFSFEDAQKAMEYSEAGRAKGKIIVKIK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgataattgataagtacgggaaagttccaatgcgtatggcagaggtacct
actcctgaaataaatgaatatgaagtactcgctgaaattcatgcagctagtattaaccca
attgactttaaaatacgtgatggaaaagtaaagatgttacttaaatatgaaatgccctta
attcttgggaatgacttttccggtgttatcgtaaaggttggatcaaaagtgactcgtttt
aaagtcggcgatgaaatatatgcacgtccaagaaaaaataagattggtactttcgcggag
tatatagccattcatgaagatgatatagctttaaaaccgaaaaatttaagttttgaagaa
gctgcttcaattccacttgttggcttaacatcatatcaagcattacatgacattatgcaa
ttacaaaaagatcaaaagattttaattcacgctggatctggtggtgttggtactttcgca
attcagttagcaaaaataatgggcgctaccgttacaacaactgctagtgaagctggttcc
gatttagtaaagtctcttggagcagatcaaattattaattacaaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcaacattgtttccgtttcaggaatgccaaatgct
cgtttcggtaaagaattcggttccggattttttaaaacattcttattttcattagcaagt
agaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggggatcaattacgtattatcgcaaattatattgaagccggaaaaatcaaaccg
gtaatcgatcgagttttttcatttgaagatgctcaaaaagcaatggaatattcagaggct
ggcagagcaaaaggaaaaataatcgtaaaaattaagtaa

DBGET integrated database retrieval system