KEGG   Bacillus cereus 03BB102: BCA_3887Help
Entry
BCA_3887          CDS       T00869                                 

Definition
sugar ABC transporter ATP-binding protein
Orthology
K02056  
simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
bcx  Bacillus cereus 03BB102
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3646273..3647805)
Genome map
AA seq 510 aa AA seqDB search
MEYVIEMNNITKVFPGIVANDDITLQVKQGEIHALLGENGAGKSTLMNVLFGLYQPEQGE
IKIKGNPVKITNPNIANDLGIGMVHQHFMLVHNFTVTENIILGNEPKKNGKIAVEEAAKE
IKQLSEQYGLAVDPHAKIEDISVGMQQRVEILKTLYRGAEILIFDEPTAVLTPQEIHELI
QIMKKLVQEGKSIILITHKLKEIMEVCDRCTIIRKGKGIGTVNVAETDEHKLAELMVGRQ
VNFKTEKIEAKPKEEVLSIANLIVHDTRKLPAVKGLDLTVRAGEIVGIAGIDGNGQSELI
EAITGLRKVESGSIAIKGKEITNWPVRRITEEGIGHIPEDRHKHGLVLDFSVRDNIVLQT
YYKNPFSKKGILNFSKITQKAKALIEQFDVRTPSEQTLARALSGGNQQKAIIAREVDRNP
DLLIAAQPTRGLDVGAIEFIHKKLIEQRDNGKAVLLLSLELDEILNVSDRVAVIYEGKIV
AIVDAKETNEQQLGLLMAGGTGKEKVNTNG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtaattgagatgaacaatattacaaaagtattcccaggcattgtagcgaat
gacgatattacgctgcaagtaaaacagggagagatacatgctttacttggagaaaatggt
gcagggaaatcaacgctgatgaatgtgttgttcggtttgtatcaaccagaacagggagag
attaaaattaaaggaaatcctgttaaaattacaaatccgaatatagcaaatgaccttggt
attgggatggtccatcagcattttatgcttgttcataattttacagttacagagaatatt
attctgggaaatgaaccgaagaaaaacgggaaaattgctgttgaagaggctgcaaaagaa
attaagcaattatctgaacagtacggtttagctgttgatccacatgcgaaaattgaagat
atttctgttgggatgcagcaaagggttgaaatattaaagactctttatcgtggtgcggag
attttaatatttgatgaaccaactgcggtgttaactcctcaagaaattcatgagttgatt
caaattatgaaaaagcttgtgcaagaggggaaatctatcattcttattacacataagtta
aaagaaattatggaagtttgcgatcgttgtacaattattcgtaaaggtaaggggattggt
actgttaatgtagcggaaactgatgagcataaacttgcagagttaatggtcggacgtcaa
gtgaattttaaaacagaaaaaatagaagctaaaccaaaggaagaagtactatctattgca
aacctaattgttcatgatacgcgcaagttacctgctgtaaaaggccttgacttaactgtt
cgtgcaggagaaatcgttgggattgcagggattgatggaaatggtcaaagtgaattaata
gaggcgattactggtttacgaaaagttgagtcaggttctattgcaattaaaggaaaagaa
ataacaaattggcctgttcgaagaataacagaagaggggattggtcatattcctgaagac
cgtcataaacacggacttgttctcgatttttctgttcgggacaatattgttttacaaaca
tactataaaaatccattttcaaagaaagggattttaaattttagtaaaatcacacaaaaa
gcaaaagcgcttattgaacagtttgatgtacgtacacctagtgaacaaacgttagctcgc
gctctatctggtggaaaccaacaaaaggcaattattgcacgtgaagtagatcgtaatcca
gatttattaattgcagcgcagccaacccgtggtttagatgtaggtgccattgaatttatt
cataaaaaattgattgagcagagagataatggtaaggcagtattgcttttatctttagag
ctagatgaaattttaaatgtaagtgatcgagttgctgttatatatgaagggaaaattgta
gcaattgtggatgcaaaagagacaaacgaacaacagcttggattattaatggccggcggg
acagggaaagagaaggtgaacacaaatggctaa

DBGET integrated database retrieval system