KEGG   Bacillus cereus 03BB102: BCA_4141Help
Entry
BCA_4141          CDS       T00869                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BCA_4141
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BCA_4141
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BCA_4141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3890892..3891668
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGNAFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAIGLKC
DVTSEEEIEASISQTVNHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAI
KHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtttttttaacaggtgctgcaagtggtattggatatgaaatg
ggaaacgcttttgcaaaagaaggtgcaaaagttgttattaccgatcgtcttgaagagcgt
gcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatcggcttaaaatgt
gatgttacatccgaagaagaaatagaagcatccatttcccaaactgttaatcatttcggt
tcattagacatattaattaataacgcaggaatgcaacacgtttcaccaattgaagatttt
ccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctccttttatcgcaatt
aagcatgccttccctattatgaaaaaacaaaaatatggccgtattataaatgtagcttcc
attaatggcctcgttggattcgctggaaaagctgcttataatagcgcaaaacatggcgta
attggattaacaaaagttgccgctttagaaggggctactcacggaattactgttaatgca
ctttgtcccggttatgtcgatacccctctcgtaaggaatcaattacaagacttggccact
acacgaaatgtaccacttgaaaatgttttagaggatgtcatttatccacttgtcccacaa
aaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcgagcgaaaaa
gctaaaggtataactggacaagctgtcgttatcgatggtggttataccgctcaataa

DBGET integrated database retrieval system