KEGG   Bacillus cereus 03BB102: BCA_4506Help
Entry
BCA_4506          CDS       T00869                                 

Definition
putative helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCA_4506
Enzymes [BR:bcx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCA_4506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4202470..4204806)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLIRETMSLLNNQEGRVAEEDVVGCIEMMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMSQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacaggacattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaaacgcacagctgaaaaaattgtg
gaccatctaggggaacatgctatttctaaaattatggatgatcctgaggctttaaacggt
gttgttaacaaacaaaaagcgcaagaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
tatcagcagtataaagagatgacattagaagtgattcgtaataacccgtaccaacttatc
gaagaagtagacgggattggttttggtagggcggatgatatagggcgtgcgttagggata
tcgggtaatcacgacgaccgtgtacgcgcaggatgtttttatacgttagagaatgtttca
ctgcaacttggtcacgtttatatgaggaaagatcaacttataagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtggctgaggaagacgttgtaggctgtattgaaatgatg
caaagtgaaggaaaagtcatcatagaagaagagcgagtgtatttagcgacgctgttctac
tctgaaaaaggtgttgtaaagtctattcgcaggcttatgagtcaagaagaaacaccttca
tttccagaagcagaagtgttaaaaacattaggcgaaattgaagaacaactgaacgtacaa
tatgcaccgtttcagcaagaagcgattcaaacggcacttcataaaccgatgatgttatta
acaggtggaccaggaacaggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacggattatcgttaaatccaaatgaatacagtgatgataatccatttcctata
ttattaacggccccaacaggaagagcagcgaagcgaatgagtgaatcaacaggtcttccg
gcttgtacaattcaccgtttacttggctggacgccagaagggtctttccagcgtaatgaa
acagatccggtacaagggaaattactcattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgactaacattcaagttatcgttgtaggcgat
gaagatcaattaccatctgtaggacctgggcaagtattgaaagatttattaaatgcaggt
gcagttccaacagtaaagcttactgaaatttatcgtcaagcggaaggttcatcagtgatt
caacttgcccatgcgataaaaaatggaacgctcccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgcacaggagctcaaattgttgaggttgttaagaaggtttgc
gaaaacgctaagacaaaagggtttagcgcaagagatgtacaagtattggccccgatgtat
cgtggaccggctggtattaatgtactaaacgaagcgttgcaagaagtttttaatccgaaa
agagaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagtt
ttgcaactcgttaatcagccggagagccaagtatttaatggtgatatcggcgaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcttattgctgt
tccattcataaatcgcaaggtagtgagtttcccattgtgattatgccgatagtgaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgcttttcagtctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctagccgcttgcaagaatcacaaggagaagtacagatggta
acggttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system