KEGG   Bacillus cereus 03BB102: BCA_4882Help
Entry
BCA_4882          CDS       T00869                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcx  Bacillus cereus 03BB102
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCA_4882
Enzymes [BR:bcx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCA_4882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4556224..4557027)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQAFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagctgaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatg
gaatatcacggacgctatgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtatcggtta
cctatttttctatttggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagacggcattattttaagttcgccatgtttaggtgtattagct
ggaccttctgcaccgcttcaagctgcctcaaaaatattaaatattatcgctccgaagtta
caatttgcaacgaatcttacagtggaaatgtcaacgcgtaatcatgaagtgagagatgcg
atggagaacgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataagaaaatagatgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttaataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcaggcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system