KEGG   Bacillus cereus 03BB102: BCA_4942Help
Entry
BCA_4942          CDS       T00869                                 

Definition
subtilisin Carlsberg (EC:3.4.21.62)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bcx  Bacillus cereus 03BB102
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4599729..4600871
Genome map
AA seq 380 aa AA seqDB search
MKKIIIRNLPLFVFTVFSLLTFFFSELNEKNAFAAEHDIKKDYLIMFNNTVDEQLIVEHG
GVIKETFENLPIIKAEFSYNPEKVLKHNSNVSEVEVDQTIKALGDSNTQTNPSMTQSKSI
NTIPFTGKGVSVAILDSGIDTEHTDLKIKDGISFVENHPSFDDDNGHGTHLAGIVAAQDN
ELGMTGIAPNVDLYAVKVLDKYTNGKYSTVVKGIDWAIEHNVNIVLMSLGGKKESAFFKE
AMDKAYQKGILLIASAGNEGYKDGDTISYPAKFQSVVAVGALDKNDARGFLSSKGDELEL
MAPGVDILSTWKDGNYRLDSGTSMAAAHVVGVASLIFEKNPYLSNKQVREIMNKAAIPLG
NAFEYGNGKINVDYALNMAD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatcattcgtaatttacccttatttgtctttactgttttctctttatta
accttcttttttagcgagttaaatgaaaaaaatgcatttgctgctgaacatgatataaaa
aaagactacttaattatgtttaataacacagttgacgaacaactaatcgttgaacatggt
ggtgttattaaagaaacctttgaaaatttacctattattaaagctgaattctcctataat
cctgaaaaagttttaaaacataatagtaatgttagtgaagtggaagtagatcaaactatt
aaagcccttggggatagtaatactcaaactaatccctcaatgacacaatcaaaatccatc
aacactattcctttcactggaaaaggggtatctgttgctatattggattcgggaattgat
acagaacatacagatttaaaaataaaagacggtatttcatttgtagagaatcacccaagt
tttgatgatgataacggtcacgggacacatttagcaggaattgtcgcagcacaagataat
gaattaggaatgacaggtatagcacctaatgtagatttatatgccgtaaaagtattagat
aaatatacaaatggaaaatacagtacagttgtaaagggaatagactgggccattgaacat
aatgtaaatattgttttaatgagcttaggaggaaagaaagagtcagcattttttaaagaa
gctatggacaaggcttatcaaaagggtatcttattaattgcctccgctggtaatgagggg
tataaggacggagatacaatttcttatcctgcaaaattccaatcagtagttgctgtcgga
gctttagataaaaatgatgcacgcggttttctttcaagtaaaggtgatgaacttgaatta
atggcacctggtgttgatattttaagtacatggaaagatggaaattacagattagatagc
ggaacatctatggcagcagcccacgtcgtgggcgttgcttcattaatatttgaaaagaac
ccttatttatcaaataaacaagttagagagattatgaataaagcggctattcctcttggt
aatgcttttgaatatggtaatggtaagataaatgtagactacgctctaaatatggcggat
taa

DBGET integrated database retrieval system