KEGG   Bacillus cereus 03BB102: BCA_5418Help
Entry
BCA_5418          CDS       T00869                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00040  Pentose and glucuronate interconversions
bcx00052  Galactose metabolism
bcx00500  Starch and sucrose metabolism
bcx00520  Amino sugar and nucleotide sugar metabolism
bcx01100  Metabolic pathways
bcx01130  Biosynthesis of antibiotics
Module
bcx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCA_5418 (galU)
   00052 Galactose metabolism
    BCA_5418 (galU)
   00500 Starch and sucrose metabolism
    BCA_5418 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BCA_5418 (galU)
Enzymes [BR:bcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCA_5418 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD Smr
Motif
Other DBs
NCBI-ProteinID: ACO27529
UniProt: A0A158RK61
Position
complement(5045795..5046670)
Genome map
AA seq 291 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSRINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMNQYEETQSSVIGVQTVPENETHRYGIIDPVEKNDR
RYQVRQFVEKPAEGTAPSNLAIMGRYVLTPEIFTFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKFGFIKTTIEMALKHEELKEELMNYMNELVKKEKM
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcgattattccagctgctggtctagggacgaggtttttacca
gcgacgaaagcgatgccgaaagaaatgttacctatcgtcgataaaccgacaattcaatac
ataatagaagaagcgatagaatcgggaattgaagatattattattgttactggaaaagga
aaacgcgcgattgaagatcattttgatcattcattcgaactagaacaaaaccttttagaa
aaaggaaagtatgaaatgcttgaaaaggtacaagcttcttcaagaattaacattcattac
ataagacagaaggaaccaaaaggacttggacatgcggtatggtgcgctcgtaaatttata
ggaaatgaaccatttgcggtattacttggtgatgatattgtacaagcagaaacaccgtgt
ttgcgtcaattaatgaatcaatatgaagagacacaatcatcggttattggtgtacaaaca
gtaccggaaaacgaaacacatcgttacggtattattgatccagttgagaaaaatgatcgt
cgttatcaagtgcgtcagtttgtagaaaagccagcagaaggcacagcaccatcaaattta
gcaattatgggtcgttacgtattaacgccagaaatttttacattccttgagaatcaacaa
acgggtgctggtggagagattcagttgacagatgcgattcaaagattaaatgaaattcaa
cgtgtgtttgcttacgattttgaaggtactcgttatgatgtaggggagaaatttgggttt
attaagactacaattgaaatggctttaaagcatgaagagttaaaagaagaattgatgaat
tatatgaatgaacttgtaaaaaaagaaaaaatgtag

DBGET integrated database retrieval system