KEGG   Bacillus cereus 03BB102: BCA_5489Help
Entry
BCA_5489          CDS       T00869                                 

Gene name
rpoE
Definition
DNA-directed RNA polymerase subunit delta (EC:2.7.7.6)
Orthology
K03048  
DNA-directed RNA polymerase subunit delta
Organism
bcx  Bacillus cereus 03BB102
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcx00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcx00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:bcx03020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5108529..5109059)
Genome map
AA seq 176 aa AA seqDB search
MDFKQYSPEELKECSMIEVVHSVLGDKRQATTFNELVQEIAQVLGLSQEQVNAKIAQFYT
DLNIDGRFINLGENRWGLRSWYPYEQIDEEILPQPKPKKKRKVEDDGFDDYIEEDEDFDD
ADVTEDEDDDVEDLDKVLEDEDGDDDDLDDLDEDEDDFAEEELEYDETEEEEEEEL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggattttaagcaatattcaccagaagagctaaaagaatgttcaatgattgaagttgta
catagcgttttaggggataaaagacaagcaacgacattcaatgagttggttcaagaaatc
gctcaagtgctgggactatctcaagagcaagttaatgcgaaaatcgcacaattttataca
gacttaaacattgatggacgtttcattaatttaggagaaaatcgttgggggctacgcagc
tggtacccatacgagcaaattgatgaagaaatcttgcctcaaccaaaaccgaagaagaaa
cgtaaagttgaagacgacggttttgacgactacattgaagaagatgaagacttcgacgat
gcagacgtaactgaagacgaagatgatgatgtagaagatttggacaaggttcttgaagat
gaagacggagatgacgatgatcttgatgatttagatgaagatgaagacgacttcgccgaa
gaagaacttgagtatgatgaaactgaagaagaagaagaggaagaactgtag

DBGET integrated database retrieval system