KEGG   Bacillus cereus 03BB102: BCA_5489Help
Entry
BCA_5489          CDS       T00869                                 

Gene name
rpoE
Definition
DNA-directed RNA polymerase subunit delta (EC:2.7.7.6)
Orthology
K03048  
DNA-directed RNA polymerase subunit delta
Organism
bcx  Bacillus cereus 03BB102
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCA_5489 (rpoE)
   00240 Pyrimidine metabolism
    BCA_5489 (rpoE)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    BCA_5489 (rpoE)
Transcription machinery [BR:bcx03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     BCA_5489 (rpoE)
DNA repair and recombination proteins [BR:bcx03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      BCA_5489 (rpoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5108529..5109059)
Genome map
AA seq 176 aa AA seqDB search
MDFKQYSPEELKECSMIEVVHSVLGDKRQATTFNELVQEIAQVLGLSQEQVNAKIAQFYT
DLNIDGRFINLGENRWGLRSWYPYEQIDEEILPQPKPKKKRKVEDDGFDDYIEEDEDFDD
ADVTEDEDDDVEDLDKVLEDEDGDDDDLDDLDEDEDDFAEEELEYDETEEEEEEEL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggattttaagcaatattcaccagaagagctaaaagaatgttcaatgattgaagttgta
catagcgttttaggggataaaagacaagcaacgacattcaatgagttggttcaagaaatc
gctcaagtgctgggactatctcaagagcaagttaatgcgaaaatcgcacaattttataca
gacttaaacattgatggacgtttcattaatttaggagaaaatcgttgggggctacgcagc
tggtacccatacgagcaaattgatgaagaaatcttgcctcaaccaaaaccgaagaagaaa
cgtaaagttgaagacgacggttttgacgactacattgaagaagatgaagacttcgacgat
gcagacgtaactgaagacgaagatgatgatgtagaagatttggacaaggttcttgaagat
gaagacggagatgacgatgatcttgatgatttagatgaagatgaagacgacttcgccgaa
gaagaacttgagtatgatgaaactgaagaagaagaagaggaagaactgtag

DBGET integrated database retrieval system