KEGG   Bacillus cytotoxicus: Bcer98_0040Help
Entry
Bcer98_0040       CDS       T00560                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00900  Terpenoid backbone biosynthesis
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01130  Biosynthesis of antibiotics
Module
bcy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcer98_0040
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bcer98_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABS20415
JGI: Bcer980040
UniProt: A7GJV7
Position
48433..49302
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELTEDRIEIVSHNRYV
PDDQRNLAYQAAKLLKEKYQVKQGVSIAIEKTIPVAAGLAGGSSDAAATLRGLNKIWNLG
LTMDELAELGAEIGSDVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPDVDQMAEAINRGDYQGICNAVGNVLEDVTFAMHPEVARIKTRMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatttgtcgttagatgtactgggaaaa
agacaagacggctatcatgaagtaaaaatgattatgacaacaatcgatttagccgatcgt
ttagagctaacagagttaacggaagatcgtattgaaatcgtgtctcataatcgatatgtc
ccagacgaccaacgtaacttggcttatcaggcagcaaaattattaaaagaaaaatatcag
gtaaaacaaggtgtatctattgcgattgaaaaaacaattccggtggcagcagggttagca
ggtggaagcagcgatgcagctgctacattacgtggccttaataaaatatggaatttagga
cttacaatggatgaactagcggaacttggcgcagagattggatccgatgtatctttttgt
gtgtatggaggaacggcaattgcaacaggaagaggagagaagattgaacatataaaaaca
cctccatcttgctgggttattttagcgaagccgcatatcggtgtgtcgactgctgacgta
tatggaaatttaaagttgaatcgtgttacacaccctgacgtcgatcaaatggccgaagcg
attaatcgtggtgattatcaggggatttgtaatgctgttggcaacgtattggaggatgtg
acatttgcgatgcatcctgaagttgcacgtattaaaacacggatgaagcgatttggggca
gatgcggttttaatgagcggcagtggtccaacggtgtttggacttgtgcatcatgattcg
agaatgcatcgtatctataatggattaaaagggttttgtgaacaggtatatgctgtacgc
ctattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system